KEGG   Arabidopsis thaliana (thale cress): AT3G03090Help
Entry
AT3G03090         CDS       T00041                                 

Gene name
VGT1
Definition
(RefSeq) vacuolar glucose transporter 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 503 aa AA seqDB search
MGFDPENQSISSVGQVVGDSSSGGITAEKEPLLKENHSPENYSVLAAIPPFLFPALGALL
FGYEIGATSCAIMSLKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGR
RKELILAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGIGLTMHAAPMYIAETAPSQIRGR
MISLKEFSTVLGMVGGYGIGSLWITVISGWRYMYATILPFPVIMGTGMCWLPASPRWLLL
RALQGQGNGENLQQAAIRSLCRLRGSVIADSAAEQVNEILAELSLVGEDKEATFGELFRG
KCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGV
SVIVIDRVGRRPLLLCGVSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVGCYQLSFGPI
GWLMISEIFPLKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSL
FFIYYIVPETKGLTLEEIEAKCL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggggtttgatcccgagaaccaatcgatctcttccgttggacaggttgttggtgattct
tcttcaggtgggattactgctgaaaaggaacctttgttaaaggaaaaccacagcccagag
aactactctgttcttgcagccattcctccgtttctctttccagctcttggagcattgctt
tttggttatgaaattggtgcaacatcttgtgctatcatgtctcttaagtcgcctactcta
agtggaatttcatggtacgacttgtcttcagtggatgttggtataattaccagtggctca
ctgtatggtgccttaattggctccattgttgcatttagtgttgccgacattataggaagg
agaaaggagctgattttggctgcattcttgtatcttgttggagccattgtgactgtagta
gcacctgtcttttccatactgataattggacgagttacgtatggcatggggattggactg
accatgcacgcggctccaatgtacattgcagagactgctccaagtcaaatacgtggacgg
atgatatcactaaaggaattctccactgtccttgggatggttgggggttatggaatcggt
agcctttggattacggttatttctggttggcgttacatgtacgcaacaattctccctttt
ccagttattatgggaactggaatgtgttggctaccagcatctccgaggtggcttttactg
cgcgctctccagggacaaggaaatggggagaatcttcaacaggctgcgattagatctctt
tgtcgccttagagggtctgtcatagctgactcagcagctgaacaagtaaacgaaatattg
gctgaactttcccttgtgggtgaagacaaagaagctacatttggtgaattatttcgaggc
aaatgcttgaaagctctcactatagcaggagggttagtcttgttccaacagataactggg
caaccaagtgtactatattatgcaccatcaatactacagactgccggcttttctgctgca
gctgatgcaactcggatctcaattctgctcggcctattgaagttggttatgacaggagtt
tctgtgatagttatcgacagagttggaaggagacctttacttctttgtggtgttagcgga
atggtgatctcattgttcctcctgggatcctactacatgttttataaaaatgtaccagct
gttgctgtagctgcattgctactgtatgtaggctgttaccagctgtcctttggccctatt
ggttggctgatgatttcagagatatttcccttaaaattaagaggtagaggaatcagtcta
gcagtgcttgtgaattttggcgcaaacgcacttgtgacattcgctttctcaccgctaaag
gagctgttaggagctggaatactgttctgtgcatttggagtgatatgtgtcgtgtctctc
ttcttcatatactacattgtgccagagacaaagggtctcactcttgaagaaattgaagcc
aaatgtctctaa

DBGET integrated database retrieval system