KEGG   Arabidopsis thaliana (thale cress): AT3G03640Help
Entry
AT3G03640         CDS       T00041                                 

Gene name
BGLU25
Definition
(RefSeq) beta glucosidase 25
  KO
K01188  
beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT3G03640 (BGLU25)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT3G03640 (BGLU25)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT3G03640 (BGLU25)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT3G03640 (BGLU25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 531 aa AA seqDB search
MALKAILFLGLFLVVIVSPITVYGGAVCPASSTFGRGSFPDGFLFGATTSAFQHEGAAEE
GGRGSSIWDSFTLKQHSESNNNLDGRLGVDFYHHYKEDVQLLKKLNMDAFRFSISWSRIF
PHGKKDKGVSETGVKFYNDLINELIANGVTPLVTLFQWDVPQALEDEYGGFLSDRILEDF
RDFAQFAFNKYGDRVKHWVTINEPYEFSRGGYETGEKAPGRCSKYVNEKCVAGKSGHEVY
TVSHNLLLAHAEAVEEFRKCGKCTGGKIGIVQSPMWFEPYDKKSTSSPSEEIVKRAMDFT
LGWHMEPITHGDYPQAMKDVVGSRLPSFTPEQKEKLKGSYDFVGINYFTSTFVAHTDNVN
PEKPSWEADSRLQLHSNNVDGFKIGSQPATAKYPVCADGLRKVLKYIKENYNDPEIIVTG
NGYKETLEEKDVLPDALSDSNRKYYHMRHLMALHGAVCEDKVNVKGYFVSSLMDGLEWED
GYKTRSGLYYVDYGHNMGRHEKQSAKWLSKLLEKVPDTIQSKVDSDSRKEL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcactcaaagcgattctctttttgggtttatttctcgtcgtgatagtttctccgatc
accgtctacggtggagctgtgtgtccggcgagttccacgtttggtcgtggaagctttcct
gatggtttcttgttcggtgctacaacttctgctttccagcatgaaggtgcagcagaagaa
ggaggccgaggttccagcatttgggactcattcactcttaaacaacattcagaaagcaac
aacaatcttgacggcaggctcggagttgatttctatcatcattacaaggaagatgttcaa
ctattgaaaaaactgaatatggatgcctttaggttctctatatcttggtcaagaatattt
ccccatgggaaaaaagacaagggagtgagtgaaacaggagttaaattctacaatgatctt
atcaacgagctcattgcaaatggtgtaacgcctcttgtcacattgtttcaatgggatgta
cctcaggctcttgaagatgaatacggcggtttcttgagtgaccgtattttggaggatttc
cgtgattttgcacagtttgctttcaataaatatggtgatagagtgaagcattgggttact
ataaacgaaccttatgaatttagtcgtggtggatacgagactggagagaaagcaccagga
agatgttctaaatatgtcaatgagaaatgtgttgcaggcaagagtggccatgaagtttac
actgttagtcacaatctgctgttggctcatgccgaagctgtggaagaattcaggaaatgt
ggaaagtgcacaggtggaaagatcggaattgttcaaagtccaatgtggtttgagccttat
gataagaaatccacctcgagtccttcagaggagatagtgaagagagctatggatttcact
ctaggctggcatatggagccaataacacatggagattaccctcaggccatgaaagatgtt
gttggtagtcgattaccatcttttacgcccgagcagaaggagaaactgaagggttcttat
gattttgtcggtatcaattacttcacttctacatttgttgctcatacggacaatgttaat
ccagagaaaccgagttgggaagctgattctcgcttgcagttacattcgaataacgttgat
gggttcaagattggttctcagcctgctactgcgaagtatcctgtttgcgctgacgggtta
agaaaagttttgaaatacatcaaagagaactacaatgacccagaaatcatagtcactgga
aacgggtacaaggagacacttgaagagaaagatgtacttccagatgccctcagcgatagt
aacaggaagtattatcatatgagacatctcatggcattacatggagcagtctgcgaggac
aaggttaatgttaaaggttactttgtgtcgtcgcttatggatggactagagtgggaagat
ggatacaagacgaggtctggactgtactatgtagactatggacacaatatgggacggcat
gagaaacaatctgccaagtggctctccaagctccttgagaaagtcccggacacgattcag
tcgaaggtagattcggattcaaggaaagagttataa

DBGET integrated database retrieval system