KEGG   Arabidopsis thaliana (thale cress): AT3G03980Help
Entry
AT3G03980         CDS       T00041                                 

Definition
(RefSeq) NAD(P)-binding Rossmann-fold superfamily protein
  KO
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AT3G03980
  Lipid metabolism
   00061 Fatty acid biosynthesis
    AT3G03980
   01040 Biosynthesis of unsaturated fatty acids
    AT3G03980
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AT3G03980
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     AT3G03980
Lipid biosynthesis proteins [BR:ath01004]
 Fatty acid synthase
  Component type
   AT3G03980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 270 aa AA seqDB search
MSTHSSISQPPLPLAGRVAIVTGSSRGIGRAIAIHLAELGARIVINYTSKAADAERVASE
INDFPVREEITGKGPRAIVVQANVSEPSQVKSMFDAAESAFEAPVHILVNSAGILDPKYP
TIADTSVEDFDHTFSVNTKGAFLCSKEAANRLKQGGGGRIILLTSSQTRSLKPGFGAYAA
SKAAVETMVKILAKELKGTGITANCVAPGPIATEMFFDGKTPELVEKIAAESPFGRVGEA
KDVVPLVGFLAGDGGEWVNGQIIPVNGGYV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacattcatcaatctcgcaaccgccgcttcctctcgccggaagagtcgccatt
gtcaccggctcttcccgtggtattggccgagcgatagcgatccacttagctgaactcggt
gcgaggattgttatcaactacacctctaaagccgcagacgccgagcgtgtcgcgtcggag
atcaatgattttccagttagggaagaaatcactggaaagggaccaagagctattgtggtt
caggccaatgtctctgagccaagccaggttaaatcaatgtttgatgcggcggagagtgcc
tttgaagcgccggttcacattctggttaactctgctgggattctcgatccaaagtaccct
acgatcgcagacacatcagtcgaagatttcgatcatacgttcagtgtcaacacaaaagga
gcgttcctgtgtagcaaggaagctgccaataggctaaaacaaggaggtggtggtcggatc
atacttctgacatcttcccagactcgatctttaaagccagggtttggtgcctatgccgca
tcaaaggcagctgtggaaactatggtcaagattcttgcaaaagagctcaaaggaacagga
atcactgcaaactgtgttgctccaggacccatcgccactgagatgttctttgatggaaag
accccagagttggtggaaaagatagccgcagagtctccctttgggagggtcggcgaagcc
aaagacgtggtgcctcttgttggattcttggctggtgacggtggtgaatgggtcaatggt
caaatcattcctgttaatggtggatatgtataa

DBGET integrated database retrieval system