KEGG   Arabidopsis thaliana (thale cress): AT3G03980Help
Entry
AT3G03980         CDS       T00041                                 

Definition
(RefSeq) NAD(P)-binding Rossmann-fold superfamily protein
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00061  Fatty acid biosynthesis
ath00780  Biotin metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01212  Fatty acid metabolism
Module
ath_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    AT3G03980
   01040 Biosynthesis of unsaturated fatty acids
    AT3G03980
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AT3G03980
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    AT3G03980
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     AT3G03980
Lipid biosynthesis proteins [BR:ath01004]
 Fatty acid synthase
  Component type
   AT3G03980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-GeneID: 819553
NCBI-ProteinID: NP_187048
MIPS: AT3G03980.1
TAIR: AT3G03980
Araport: AT3G03980
UniProt: Q9SQR4
Position
3
AA seq 270 aa AA seqDB search
MSTHSSISQPPLPLAGRVAIVTGSSRGIGRAIAIHLAELGARIVINYTSKAADAERVASE
INDFPVREEITGKGPRAIVVQANVSEPSQVKSMFDAAESAFEAPVHILVNSAGILDPKYP
TIADTSVEDFDHTFSVNTKGAFLCSKEAANRLKQGGGGRIILLTSSQTRSLKPGFGAYAA
SKAAVETMVKILAKELKGTGITANCVAPGPIATEMFFDGKTPELVEKIAAESPFGRVGEA
KDVVPLVGFLAGDGGEWVNGQIIPVNGGYV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacattcatcaatctcgcaaccgccgcttcctctcgccggaagagtcgccatt
gtcaccggctcttcccgtggtattggccgagcgatagcgatccacttagctgaactcggt
gcgaggattgttatcaactacacctctaaagccgcagacgccgagcgtgtcgcgtcggag
atcaatgattttccagttagggaagaaatcactggaaagggaccaagagctattgtggtt
caggccaatgtctctgagccaagccaggttaaatcaatgtttgatgcggcggagagtgcc
tttgaagcgccggttcacattctggttaactctgctgggattctcgatccaaagtaccct
acgatcgcagacacatcagtcgaagatttcgatcatacgttcagtgtcaacacaaaagga
gcgttcctgtgtagcaaggaagctgccaataggctaaaacaaggaggtggtggtcggatc
atacttctgacatcttcccagactcgatctttaaagccagggtttggtgcctatgccgca
tcaaaggcagctgtggaaactatggtcaagattcttgcaaaagagctcaaaggaacagga
atcactgcaaactgtgttgctccaggacccatcgccactgagatgttctttgatggaaag
accccagagttggtggaaaagatagccgcagagtctccctttgggagggtcggcgaagcc
aaagacgtggtgcctcttgttggattcttggctggtgacggtggtgaatgggtcaatggt
caaatcattcctgttaatggtggatatgtataa

DBGET integrated database retrieval system