KEGG   Arabidopsis thaliana (thale cress): AT3G04790Help
Entry
AT3G04790         CDS       T00041                                 

Definition
(RefSeq) ribose 5-phosphate isomerase A
  KO
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT3G04790
   01230 Biosynthesis of amino acids
    AT3G04790
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT3G04790
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT3G04790
Enzymes [BR:ath01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     AT3G04790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 276 aa AA seqDB search
MASLSFVSSSHLTLRTPSIALRSTGSSPRTSVSFSVKAQSVALSQDDLKKLAAEKAVEAI
KPGMVLGLGTGSTAAFAVDQIGKLLSSGELYDIVGIPTSKRTEEQARSLGIPLVGLDTHP
RIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAVADKFIVVADDTKLVTGLGGSGLAMP
VEVVQFCWNFNLIRLQDLFKEFGCESKLRVDGDGKPYVTDNSNYIIDLYFKTPLKDGFAA
AKEIGKFQGVVEHGLFLGMATSVIIAGKNGVEVMTK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcttccttatccttcgtttcctcttctcaccttacgctacgcactccttctattgcc
ctacgcagcactggctcttctcctcgaacctccgtttcattctccgtcaaggctcaatcc
gtcgcgctttcacaggacgatttgaagaagctcgcggcggagaaagctgtggaggcaatt
aaacctgggatggttctagggctcggaaccggatccaccgcagctttcgctgttgatcag
atcgggaaactactctcttccggtgaactctacgatattgtcggtatcccaacgtcgaaa
cgaacggaggaacaagcacggtcgttagggattcctcttgttgggttagatacacatccg
agaatcgatctcgctattgacggagcagacgaggtagatccgaatcttgatttagtcaaa
ggtcgtggaggtgctcttctccgtgagaaaatggtggaagctgtggctgacaagtttatt
gttgtggctgatgataccaaactcgttacaggactcggtggaagtggattagctatgccg
gtggaagttgttcaattctgctggaactttaatttgattagattgcaagacctcttcaag
gaatttggatgtgaatcaaagcttagagttgatggtgatggcaagccttatgtgactgat
aacagtaattacattattgatttgtattttaagactcctttgaaggatggattcgctgcg
gctaaagagattgggaagtttcaaggagtggtggagcatggtctgtttctcggaatggct
acttctgtcattatcgctggaaagaatggcgttgaagttatgaccaagtga

DBGET integrated database retrieval system