KEGG   Arabidopsis thaliana (thale cress): AT3G04790Help
Entry
AT3G04790         CDS       T00041                                 

Gene name
EMB3119
Definition
(RefSeq) Ribose 5-phosphate isomerase, type A protein
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00030  Pentose phosphate pathway
ath00710  Carbon fixation in photosynthetic organisms
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ath_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
ath_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ath_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
ath_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT3G04790 (EMB3119)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT3G04790 (EMB3119)
Enzymes [BR:ath01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     AT3G04790 (EMB3119)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-GeneID: 819639
NCBI-ProteinID: NP_187130
MIPS: AT3G04790.1
TAIR: AT3G04790
Araport: AT3G04790
UniProt: Q9S726 A0A178V804
Position
3
AA seq 276 aa AA seqDB search
MASLSFVSSSHLTLRTPSIALRSTGSSPRTSVSFSVKAQSVALSQDDLKKLAAEKAVEAI
KPGMVLGLGTGSTAAFAVDQIGKLLSSGELYDIVGIPTSKRTEEQARSLGIPLVGLDTHP
RIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAVADKFIVVADDTKLVTGLGGSGLAMP
VEVVQFCWNFNLIRLQDLFKEFGCESKLRVDGDGKPYVTDNSNYIIDLYFKTPLKDGFAA
AKEIGKFQGVVEHGLFLGMATSVIIAGKNGVEVMTK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcttccttatccttcgtttcctcttctcaccttacgctacgcactccttctattgcc
ctacgcagcactggctcttctcctcgaacctccgtttcattctccgtcaaggctcaatcc
gtcgcgctttcacaggacgatttgaagaagctcgcggcggagaaagctgtggaggcaatt
aaacctgggatggttctagggctcggaaccggatccaccgcagctttcgctgttgatcag
atcgggaaactactctcttccggtgaactctacgatattgtcggtatcccaacgtcgaaa
cgaacggaggaacaagcacggtcgttagggattcctcttgttgggttagatacacatccg
agaatcgatctcgctattgacggagcagacgaggtagatccgaatcttgatttagtcaaa
ggtcgtggaggtgctcttctccgtgagaaaatggtggaagctgtggctgacaagtttatt
gttgtggctgatgataccaaactcgttacaggactcggtggaagtggattagctatgccg
gtggaagttgttcaattctgctggaactttaatttgattagattgcaagacctcttcaag
gaatttggatgtgaatcaaagcttagagttgatggtgatggcaagccttatgtgactgat
aacagtaattacattattgatttgtattttaagactcctttgaaggatggattcgctgcg
gctaaagagattgggaagtttcaaggagtggtggagcatggtctgtttctcggaatggct
acttctgtcattatcgctggaaagaatggcgttgaagttatgaccaagtga

DBGET integrated database retrieval system