KEGG   Arabidopsis thaliana (thale cress): AT3G05580Help
Entry
AT3G05580         CDS       T00041                                 

Definition
serine/threonine-protein phosphatase PP1 isozyme 9
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:ath03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 318 aa AA seqDB search
MMTSMEGMMEMGVLDDIIRRLLEGKGGKQVQLSEVEIRQLCVNARQIFLSQPNLLELHAP
IRICGDIHGQYQDLLRLFEYGGYPPSANYLFLGDYVDRGKQSLETICLLLAYKIRYPSKI
FLLRGNHEDAKINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALIDEKILCMHGGLSP
ELENLGQIREIQRPTEIPDNGLLCDLLWSDPDQKNEGWTDSDRGISCTFGADVVADFLDK
NDLDLICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLSVDQSLVCSFEILKP
APASSTNPLKKVPKMGKS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgagtatggaagggatgatggagatgggtgtattggatgatattataaggaga
ttgttggaaggtaaaggaggtaaacaggttcagctttcggaggtcgagatccgtcaactt
tgcgttaacgccagacaaatcttcctttctcagcctaatcttctcgagcttcatgccccc
attcgcatctgcggtgatatccatggacagtaccaagatcttctgaggctattcgaatac
ggaggctatcctccttcagcgaactatctcttcctcggcgattacgttgatagaggcaag
caaagtcttgaaacaatatgtttactcttggcttacaaaatccggtacccatccaagata
tttctcttgagaggaaaccatgaagatgctaagatcaacaggatttacgggttctatgac
gaatgcaaacggaggtttaatgtacggctttggaagatattcaccgattgcttcaactgt
ttgccggtagctgctctcattgacgagaagatcctatgtatgcatggtggattgtcaccg
gaattggaaaacttggggcagattcgggagattcaaaggcctacagagattccagacaat
ggtcttctttgtgatttactttggtctgatcctgatcagaagaatgaagggtggactgat
agcgatcgaggtatctcctgcacgtttggagccgatgtagtcgctgactttttggataag
aatgatctcgatctcatttgcagaggccatcaggtagtggaagatgggtatgagtttttc
gcaaaacggaggttagtcacaatattctcagctccaaactatggaggagagtttgacaat
gccggtgcattattgagcgtggatcaatctctcgtttgctcctttgagattctgaaaccg
gctccagcttctagcactaatcctctcaagaaggtaccgaaaatggggaagtcttga

DBGET integrated database retrieval system