KEGG   Arabidopsis thaliana (thale cress): AT3G06050Help
Entry
AT3G06050         CDS       T00041                                 

Gene name
PRXIIF
Definition
(RefSeq) peroxiredoxin-2F
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 201 aa AA seqDB search
MAMSILKLRNLSALRSAANSARIGVSSRGFSKLAEGTDITSAAPGVSLQKARSWDEGVSS
KFSTTPLSDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVICVSVNDP
FAINGWAEKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAV
NVEEAPSDFKVTGAEVILGQI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgtcaattctaaagctaagaaatttatcggcactaagatcggcggcaaatagt
gcccggatcggagtttcatcgaggggtttctcaaagctcgcggaaggcactgacataacc
tcggcggcgcctggcgtttctctccagaaagctcgcagctgggacgaaggtgtttcctcc
aaattctccaccacgccattgtcagatatcttcaaggggaagaaagtcgtcatctttggt
cttcctggggcttacacgggagtttgttcacagcagcatgtgcctagctacaagagccac
attgataagtttaaagccaaaggcattgattctgtcatctgtgtctctgttaatgatccc
tttgctatcaatggttgggcagagaagcttggtgccaaagatgcaattgagttttatgga
gattttgatgggaaatttcacaaaagcttggggctagacaaggatctctctgctgcattg
ctcgggccacggtctgagagatggtcggcttatgtagaagacgggaaggttaaggcggtg
aatgtggaagaagcaccgtctgacttcaaggttacaggggcagaagtcatcttaggacag
atctaa

DBGET integrated database retrieval system