KEGG   Arabidopsis thaliana (thale cress): AT3G06860Help
Entry
AT3G06860         CDS       T00041                                 

Gene name
MFP2
Definition
fatty acid beta-oxidation multifunctional protein MFP2
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ath01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ath00071]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ath00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 725 aa AA seqDB search
MDSRTKGKTVMEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGA
KGRFSGGFDISGFGEMQKGNVKEPKAGYISIDIITDLLEAARKPSVAAIDGLALGGGLEL
AMACHARISAPAAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILTSKPVKAEEGHS
LGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLGEAREILTFAKAQTLK
RAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKGLIHVFFSQRGTAKVP
GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQ
SRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH
CILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQVIVDLLDVG
KKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRAISKFGMPMGPFRLCD
LVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPEL
KKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIM
GMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLAERGSKGVLLSAPVKQ
ASSRL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggattcacgaaccaaggggaagacggtgatggaagttggtggcgatggcgttgccgtc
ataacactcatcaatcctcccgtcaattctctatccttcgacgtgctatacaatctcaaa
agtaattacgaggaggccttgagcaggaatgatgttaaagctattgttattactggtgca
aaggggaggttctctggtggctttgatatatctggttttggtgaaatgcagaaggggaat
gtcaaagagccaaaggctggttacatttcgattgacatcataaccgacttgcttgaagct
gctaggaaaccgtctgtcgctgccattgatggacttgccttgggaggaggattagaactt
gctatggcttgtcatgctaggatatcagctcctgctgcacagttaggcttgcctgagctg
caacttggtgttattcctggttttggaggaacgcagcgtctcccgcgtcttgttggtctc
accaaagcccttgaaatgattttgacatctaagccagttaaagctgaggaaggtcattct
ttgggtcttattgatgctgtggtgccacctgcggagttagtaaccactgctcgtcgctgg
gcccttgacatagtcgggaggagaaaaccatgggtatctagtgtttccaagactgataag
ttacctcctcttggagaggcaagggagatactgacgtttgccaaggcacagacactcaag
cgtgcccccaatatgaaacaccctttaatgtgccttgacgctattgaagtaggtattgtt
tctggtccaagggctggtttagaaaaggaagctgaagtcgcctcacaagtggtaaaactg
gataccaccaaaggcttgatccacgtcttcttttctcagcgaggaactgctaaggttcct
ggagttactgatcgtgggttggtgccaaggaagattaagaaggtagccataattggaggc
gggttgatgggatctggaatagctactgcgttgatcctaagtaactatccagtgattctc
aaggaggtaaatgagaaattcctggaggctggaattggcagagttaaagctaatctccag
agccgtgtaaggaagggaagcatgtctcaggaaaagtttgagaaaaccatgtctctcctt
aagggttctcttgattatgaaagctttagagatgtggacatggtcattgaggctgttatt
gagaatatatctttgaagcaacaaatttttgctgatctggagaaatactgtcctcagcat
tgtatccttgctagcaacacatcgaccattgacttgaacaaaattggggagcggaccaag
tctcaggatcgaattgttggagcacattttttcagtccagcacatatcatgccgctactt
gaaatagttcggaccaatcatacctctgcccaagtaattgttgacctgttagatgttggg
aagaagattaagaaaacaccagttgtggtgggaaactgcacagggtttgcagtgaatagg
atgttcttcccttacacacaggcagctatgttccttgttgagtgtggagcagatccatat
ctaatcgacagggcaatcagcaagtttggaatgccaatgggtcccttcagactgtgtgac
ctggttggatttggtgtggcgattgcaaccgcaacgcagtttatcgagaacttctcagaa
cggacttacaaatcaatgattattccacttatgcaagaggacaagagagctggtgaagcc
actcgcaaaggtttctatttgtatgatgataagcgcaaggcgaaacctgatcctgagcta
aagaaatatatcgaaaaggcaagaagcatatctggagtaaagcttgaccctaagttggcg
aatttgtcggagaaggacattattgaaatgacattcttcccagtagtaaacgaggcgtgt
agggtttttgctgaaggtatcgctgtcaaagcagcagaccttgacattgctggcataatg
ggaatgggttttccaccttacagaggaggaatcatgttctgggctgattccatcggatcg
aaatacatttactcgaggctggatgagtggtcgaaggcttatggtgaattcttcaagcct
tgtgcttttttggctgagaggggatctaaaggagttcttttgagcgctcccgtgaaacaa
gccagctcacggttgtaa

DBGET integrated database retrieval system