KEGG   Arabidopsis thaliana (thale cress): AT3G08510Help
Entry
AT3G08510         CDS       T00041                                 

Gene name
PLC2
Definition
phosphoinositide phospholipase C 2
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AT3G08510 (PLC2)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AT3G08510 (PLC2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     AT3G08510 (PLC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 581 aa AA seqDB search
MSKQTYKVCFCFRRRFRYTASEAPREIKTIFEKYSENGVMTVDHLHRFLIDVQKQDKATR
EDAQSIINSASSLLHRNGLHLDAFFKYLFGDNNPPLALHKVHHDMDAPISHYFIFTGHNS
YLTGNQLSSDCSEVPIIDALKKGVRVIELDIWPNSNKDDIDVLHGMTLTTPVGLIKCLKA
IRAHAFDVSDYPVVVTLEDHLTPDLQSKVAEMVTEIFGEILFTPPVGESLKEFPSPNSLK
RRIIISTKPPKEYKEGKDVEVVQKGKDLGDEEVWGREVPSFIQRNKSEAKDDLDGNDDDD
DDDDEDKSKINAPPQYKHLIAIHAGKPKGGITECLKVDPDKVRRLSLSEEQLEKAAEKYA
KQIVRFTQHNLLRIYPKGTRVTSSNYNPLVGWSHGAQMVAFNMQGYGRSLWLMQGMFRAN
GGCGYIKKPDLLLKSGSDSDIFDPKATLPVKTTLRVTVYMGEGWYFDFRHTHFDQYSPPD
FYTRVGIAGVPGDTVMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDD
FGGQTCLPVWELSEGIRAFPLHSRKGEKYKSVKLLVKVEFV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcaaacgtacaaagtgtgtttctgctttcgccggaggtttcgttacactgca
tcggaggcaccgcgtgagatcaagaccattttcgaaaagtactcagagaatggagttatg
accgttgatcatctccacaggtttctgatcgatgttcagaaacaagataaagccaccaga
gaagatgcacagtcaattatcaattctgcatcttctcttcttcatcgtaatggtctccat
cttgatgctttcttcaagtacctctttggtgataataaccctcctcttgctctccataag
gtgcatcatgacatggatgctcctatatcgcattatttcatattcactggtcataattct
tatctgactggtaatcagctgagcagtgactgtagtgaggtacctattattgatgcgttg
aagaaaggtgttagagtcattgaattggatatatggcccaattccaacaaagacgatatt
gatgttcttcacggaatgactctcactacacctgtggggttgatcaaatgtctcaaagct
atcagagcacatgcctttgatgtatctgactatcctgttgttgtaactcttgaagatcat
cttactccagatcttcagtctaaagttgctgagatggttactgagatatttggggaaatt
ctgtttactcctcctgtgggagaatctttgaaggagttcccatcgccaaactctttaaaa
agacgtattatcatctcaaccaaacccccaaaagagtacaaggaaggaaaagatgtggaa
gtggtgcagaaaggtaaagacttgggggatgaagaagtttggggaagagaagttccgagc
tttattcagaggaacaaaagtgaagctaaggatgacttagatggaaatgatgatgatgac
gatgatgatgatgaagacaagtctaagattaatgcaccaccccagtataaacatttgatt
gcaatccatgctgggaaaccaaaaggcggaattactgagtgtttaaaggtagatcctgac
aaggttagacgccttagcttaagcgaagaacaacttgaaaaggcagcagaaaaatatgcg
aagcagattgtgaggtttactcagcacaatttgctgaggatatacccaaaaggaactaga
gtcacatcatcaaattacaacccgttggttggctggagccacggtgctcaaatggtggct
ttcaatatgcaggggtatggaagatcattgtggctaatgcagggaatgtttagagccaat
ggcggatgtggctacatcaagaaacctgaccttctgctgaaaagtggttcggatagtgac
atatttgacccaaaagctactctacctgtgaaaacaacacttagggtaactgtatacatg
ggagaaggctggtactttgatttccgccacacacactttgaccaatattcaccgcctgac
ttctatacaagggttgggatagctggagttccaggggatacagtaatgaagaagacgaaa
acactggaggataattggataccagcttgggatgaggtgtttgagttcccattaaccgtt
ccagagctggccctgctacgattagaagtgcatgagtatgacatgtcagagaaagatgat
tttggaggacagacatgcttaccggtttgggagctaagcgaaggaataagagcatttcct
ttacatagccggaaaggagagaagtacaaatccgttaagcttctcgtgaaggtggagttt
gtgtga

DBGET integrated database retrieval system