KEGG   Arabidopsis thaliana (thale cress): AT3G08530Help
Entry
AT3G08530         CDS       T00041                                 

Definition
Clathrin, heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AT3G08530
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT3G08530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 1703 aa AA seqDB search
MAAANAPITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ
PLRRPITADSALMNPNSKILALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVVFWKWI
TPKMLGLVTQNSVYHWSIEGDSEPVKMFDRTANLANNQIINYKCSPNEKWLVLIGIAPGS
PERQQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSILISFASKSFNAGQITS
KLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGLLFVYDL
ETASAIYRNRISPDPIFLTSEASSVGGFYAINRRGQVLLATVNEATIIPFISGQLNNLEL
AVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGILRTPDTVAKFQSVPVQ
AGQTPPLLQYFGTLLTRGKLNSYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQ
GAVNFALMMSQMEGGSPVDYNTITDLFLQRNLIREATSFLLDVLKPNLPEHAFLQTKVLE
INLVTFPNVADAVLANGMFTHYDRPRIAQLCEKAGLYIQSLKHYSELPDIKRVIVNTHAI
EPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDACIKLFEQFK
SYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEA
KLPDARPLINVCDRFSFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE
DFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDS
NNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDGDLWDKVLDENNDYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIE
LLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYE
EAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDSVWSQVAKAQLREGLVSDAIE
SFIRADDATHFLEVIRVSEDTDVYDDLVKYLLMVRQKVKEPKVDSELIYAYAKIDRLGEI
EEFILMPNVANLQHVGDRLYDEALYEAAKIIYAFISNWGKLAVTLVKLQQFQGAVDAARK
ANSAKTWKEVCFACVDAEEFRLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESG
LGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIPKLIRACDEQQHWQELTYLYI
QYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDIINDLLNVL
ALRLDHTRVVDIMRKAGHLRLIKPYMIAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDL
HDSFDQIGLAQKIEKHELVEMRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGE
HELAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALELAWINNMMDFAFPYLLQFIREY
SGKVDELIKDKLEAQKEVKAKEQEEKDVISQQNMYAQMLPLALPAPPMPGMGGGGGYGPP
PQMGGMPGMPPMPPYGMPPMGGY
NT seq 5112 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgccaacgcccccatcacgatgaaggaggtcctgacgcttccgagcatcggg
atcaatcagcaattcatcacgtttacaaatgttactatggagtctgacaagtatatctgt
gtacgagagacgtcaccgcaaaacagtgttgtaattatagatatgaatatgccgatgcag
cctcttaggaggcctattactgcagactctgctcttatgaacccaaactcgaagatcctt
gccttgaaagctcaagttccaggaactactcaggatcatctacagatatttaacattgaa
gccaaagcaaagttgaaatcacatcagatgcctgagcaggttgtcttttggaagtggatt
acaccaaagatgttggggctggtcacacagaattccgtctatcattggtcaattgaaggt
gattctgagccagttaagatgtttgatagaacagccaatttggccaacaatcaaattata
aactataagtgctctcctaatgagaagtggttggttttaattggaattgctcctggctct
cctgagagacaacaattggtaaaaggaaatatgcagcttttctctgtggatcaacagcgg
agtcaggcccttgaggcacatgctgcatcgtttgcgcagtttaaggttcctgggaatgag
aatccttctattcttatatcatttgcaagcaagagctttaatgctgggcagataacatca
aagttgcatgtcattgagcttggtgcccaacctggaaaaccatcatttacaaaaaaacaa
gcagatctcttttttccccctgattttgctgatgattttcctgttgccatgcaggtctct
cacaaatttaacttgatatatgttatcaccaaacttggcctgttgtttgtgtacgatcta
gagactgcttctgctatctacagaaatcggattagtccagacccaattttcttgacttct
gaagcttcctcagttgggggtttctatgccattaataggcgaggacaagttcttttggct
acagtaaacgaggctaccattataccttttattagtggccaattgaacaatttggagctt
gctgtcaatcttgctaaaagaggaaacctcccaggtgcagaaaatctggttgtccagcgg
ttccaggagttgttcgctcaaacaaagtacaaggaggctgctgagcttgctgctgaatct
cctcaaggaattctaaggacacctgatacagtggccaaattccagagtgttcctgtacaa
gctggacaaactcctccattgttacagtattttgggactcttttgactagagggaaactc
aattcatatgagtcactggaactatctcggctggttgtgaaccaaaacaagaagaacctc
ctggaaaactggttggcagaggataaactagaatgcagtgaagaacttggagaccttgtg
aagactgtggataatgatctcgctctgaaaatatacatcaaagctcgggcgactccaaaa
gttgtagcagcttttgcagaaagaagggagtttgacaaaatactgatttactcaaagcag
gttgggtacacacctgattacctgtttcttctgcaaaccatactccgtacagatcctcag
ggagcagtaaattttgcattaatgatgtctcaaatggaaggaggttctccagttgactac
aacaccatcactgatctttttcttcagagaaatctgatccgtgaagcgacttctttcctt
ctggatgtgctaaagccaaatttacctgagcatgcttttctgcaaactaaggttctggag
ataaatttggtaacttttcctaatgtggctgatgcggtattagcaaatgggatgttcacc
cactatgaccggcctcgcattgctcaactttgtgaaaaggctggactttatatccaatcc
ttgaagcattactcagagttacctgatataaaacgtgtaattgtaaacacacatgctatc
gagccacaggctcttgttgagttttttggcactctttctagcgagtgggctatggagtgc
atgaaggatctgttgctggtcaacctgagaggcaatctgcagataattgttcaggcttgc
aaggagtactgtgagcaacttggtgttgatgcatgtattaagctctttgagcagttcaag
tcatatgaagggctatactttttcctaggttcatatttgagtatgagtgaggatcctgag
atccatttcaagtacattgaagcagctgccaagactggtcaaataaaggaggttgagcgt
gtaactagagagtctaacttctatgatgctgaaaagacgaagaactttttgatggaagct
aagctgcctgatgcacgacctttgataaatgtctgtgatcgtttcagctttgtgcctgat
cttactcattacctctacacaaacaacatgcttcgttacattgaaggctacgtgcagaag
gtgaaccctgggaatgctcccttagttgtcgggcagttgcttgatgatgaatgccctgaa
gattttataaaaggcctcattctctctgttcgttcattgcttcctgttgaaccacttgtc
gaggaatgtgagaagagaaatcgactccgtctcctcactcagttcttggagcatttagtt
agtgagggaagccaagatgtgcatgtccataatgccttgggtaaaattatcatagacagt
aacaacaaccctgagcatttcctgaccaccaacccttactacgactctaaggttgtgggt
aagtactgcgagaaacgtgatcctaccctagcagttgtggcatacagaagaggacaatgt
gacgaggaactcatcaatgtcactaacaaaaactctttgtttaagttacaagccaggtat
gtagtggagaggatggatggtgatctgtgggataaggttctcgatgaaaacaatgattat
agaagacagcttattgaccaagttgtgtctactgctttacctgaaagcaagagcccagag
caagtttctgcagctgttaaagcattcatgactgctgatttgccgcacgagcttattgag
cttcttgaaaagattgttctacaaaattctgccttcagtggaaacttcaatctgcaaaat
ctgcttatattgacagctattaaggcagatccgtctagagttatggattacatcaacagg
ctggacaactttgatggacctgcagttggagaagtcgcagttgaagcccaattatatgag
gaagcatttgctatcttcaagaagttcaacttaaatgttcaggctgtcaatgtattgctg
gataatgtcaggagcattgagcgtgcagttgagtttgcattccgggtcgaagaagattct
gtttggagccaagtcgctaaggcgcaactcagggaaggactagtcagtgatgcaattgag
tcctttatccgtgctgatgatgccactcatttcttggaggtcatacgtgtctctgaagat
actgatgtctatgatgacttggtcaaataccttctgatggttagacagaaggtgaaggaa
cccaaggttgatagtgagctcatctatgcatatgcaaagattgatcggttaggtgagatt
gaagaattcattctgatgccaaacgttgctaatctacaacatgttggtgatcgtctgtat
gacgaagctctctatgaggctgcaaaaataatctatgcgttcatatcaaactggggcaag
ttagccgtcacacttgtgaagttgcaacagttccaaggtgctgttgatgctgcaaggaaa
gcaaacagtgcaaagacatggaaggaagtctgctttgcttgcgttgatgctgaggaattc
cggttggctcaaatatgtggtcttaacattatcattcaggtggatgacctggaagaagtc
agcgagtactaccagaacagagggtgcttcaatgaattaatctcacttatggagagtgga
cttgggcttgaacgtgctcacatgggtatcttcaccgagttgggtgtactctatgctaga
tatcgttatgagaaacttatggaacacatcaagttattttcaactcgcctcaatattccc
aagcttatacgggcctgtgatgaacaacagcactggcaggaacttacctatctgtacatt
caatatgatgagtttgataatgctgcgaccaccgtcatgaaccattctcctgaagcatgg
gagcacatgcaattcaaagacattgttgccaaggtagcgaatgttgaactgtactacaag
gctgtgcacttctacttgcaagagcatccggatataatcaacgatcttctcaacgtactt
gcgttgcggttagaccatactcgtgttgttgatataatgcggaaggctggtcacttgcgt
cttatcaagccatacatgattgcagttcagagcaacaatgtctctgctgttaatgaggct
ctgaatgagatatacgtggaagaagaagactacgataggttgcgagagtctattgattta
catgacagctttgaccagattggcctcgctcagaagatcgagaaacacgaacttgttgaa
atgagacgtgtggctgcttatatctacaagaaagcgggcagatggaagcaatcaattgca
ttatcaaagaaagacaacatgtacaaggactgtatggaaacggcttcacaatcaggcgaa
catgaacttgcagaacaactactggtgtatttcattgaacagggcaaaaaggaatgcttt
gctacatgtctctttgtatgttatgacttaatccgaccagacgtggctctagaacttgcc
tggatcaacaatatgatggactttgccttcccgtatctcctccagtttatccgagagtac
tctggcaaagtggatgagctaataaaggacaagcttgaggcacaaaaagaggtgaaggcc
aaagagcaggaagagaaggatgtcatatcccaacagaacatgtatgcccaaatgttgcca
cttgctttacctgcaccaccgatgccaggaatgggaggtggtggtgggtatggtcctcca
ccacaaatgggcggtatgccaggaatgcctcccatgccaccatatggaatgccaccgatg
ggcggctactaa

DBGET integrated database retrieval system