KEGG   Arabidopsis thaliana (thale cress): AT3G08730Help
Entry
AT3G08730         CDS       T00041                                 

Gene name
PK1
Definition
(RefSeq) protein-serine kinase 1
  KO
K04688  
p70 ribosomal S6 kinase [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:ath00001]
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    AT3G08730 (PK1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT3G08730 (PK1)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   AT3G08730 (PK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 465 aa AA seqDB search
MVSSQRPVPNKIQKQQYLSISPSNSVLKDDVELEFSDVFGPLPEEANDIAYDEPAVVYSR
SHSLVGPCSLDSHSLKLTKLTLLETEDSIDLVECLEGESLKENDDFSGNDDSDNEKALEG
DLVKVSGVVGIDDFEVMKVVGKGAFGKVYQVRKKETSEIYAMKVMRKDHIMEKNHAEYMK
AERDILTKIDHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAE
IVSAVSHLHEKGIMHRDLKPENILMDTDGHVMLTDFGLAKEFEENTRSNSMCGTTEYMAP
EIVRGKGHDKAADWWSVGILLYEMLTGKPPFLGSKGKIQQKIVKDKIKLPQFLSNEAHAI
LKGLLQKEPERRLGSGLSGAEEIKQHKWFKGINWKKLEAREVMPSFKPEVSGRQCIANFD
KCWTDMSVLDSPASSPSSDPKANPFTNFTYVRPPPSFLHQSTTTL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctctcagcgtcctgtccccaacaaaatccagaaacagcaatatctatccatc
agcccttcaaattctgtcttgaaagatgatgttgaacttgagttctctgatgtgtttggt
ccactccccgaagaggccaatgatattgcttacgacgagcctgctgttgtctacagtcga
tcccactccttggttggcccgtgttcgctcgatagtcattctttgaagctgaccaagctc
accttactagagactgaggactcaattgacttggtggagtgtctcgaaggtgaatcttta
aaagaaaatgatgatttctctggtaatgacgacagtgacaatgagaaagctttagaggga
gatctggtgaaagtctcaggtgtagtaggcatagatgattttgaggttatgaaggttgtt
gggaaaggtgcgtttgggaaagtctaccaggtgaggaaaaaggagacctctgagatatac
gctatgaaagtcatgaggaaagatcacattatggagaagaaccatgctgaatacatgaaa
gctgagcgcgatattcttacaaaaattgatcacccattcattgttcaacttaaatactct
tttcagaccaagtacaggctgtatcttgtgctcgactttataaacggaggtcatcttttc
ttccaactctatcaccaagggcttttcagagaggacttggctcgagtgtacactgcagaa
atcgtctctgcagtttcccatctccatgagaaaggcataatgcacagagatctgaaaccc
gaaaacatactcatggatacagatggccacgtgatgctaacagattttggtttagcaaag
gaatttgaagaaaacacaagatcaaactccatgtgcggaactacggagtatatggcacct
gaaattgttcgaggaaaaggacatgataaagcagctgactggtggagcgtagggattctt
ctgtatgagatgctcacaggaaagccaccgtttctcgggagcaaaggaaagatacagcag
aaaattgtgaaggacaagatcaagcttccgcagtttctgtctaatgaagctcatgcaata
ctgaaagggctgctgcaaaaagagccagaaaggcgacttggaagtggactgagcggagca
gaggagataaaacagcacaaatggttcaagggaataaactggaagaagctggaggctaga
gaagtgatgccaagtttcaagccggaagtatcgggaaggcaatgcatagcaaattttgac
aagtgttggactgacatgtctgttttggattctccggcgagcagtcccagttcggatcct
aaggccaacccttttaccaatttcacttacgtcaggcctcctccttcattccttcaccag
tccacaactactttgtag

DBGET integrated database retrieval system