KEGG   Arabidopsis thaliana (thale cress): AT3G08730Help
Entry
AT3G08730         CDS       T00041                                 

Gene name
PK1
Definition
(RefSeq) protein-serine kinase 1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT3G08730 (PK1)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   AT3G08730 (PK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_C FTA2 APH RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 820020
NCBI-ProteinID: NP_001326081
MIPS: AT3G08730.1
TAIR: AT3G08730
Araport: AT3G08730
UniProt: P42818 A0A178VLF0
Position
3
AA seq 465 aa AA seqDB search
MVSSQRPVPNKIQKQQYLSISPSNSVLKDDVELEFSDVFGPLPEEANDIAYDEPAVVYSR
SHSLVGPCSLDSHSLKLTKLTLLETEDSIDLVECLEGESLKENDDFSGNDDSDNEKALEG
DLVKVSGVVGIDDFEVMKVVGKGAFGKVYQVRKKETSEIYAMKVMRKDHIMEKNHAEYMK
AERDILTKIDHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAE
IVSAVSHLHEKGIMHRDLKPENILMDTDGHVMLTDFGLAKEFEENTRSNSMCGTTEYMAP
EIVRGKGHDKAADWWSVGILLYEMLTGKPPFLGSKGKIQQKIVKDKIKLPQFLSNEAHAI
LKGLLQKEPERRLGSGLSGAEEIKQHKWFKGINWKKLEAREVMPSFKPEVSGRQCIANFD
KCWTDMSVLDSPASSPSSDPKANPFTNFTYVRPPPSFLHQSTTTL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctctcagcgtcctgtccccaacaaaatccagaaacagcaatatctatccatc
agcccttcaaattctgtcttgaaagatgatgttgaacttgagttctctgatgtgtttggt
ccactccccgaagaggccaatgatattgcttacgacgagcctgctgttgtctacagtcga
tcccactccttggttggcccgtgttcgctcgatagtcattctttgaagctgaccaagctc
accttactagagactgaggactcaattgacttggtggagtgtctcgaaggtgaatcttta
aaagaaaatgatgatttctctggtaatgacgacagtgacaatgagaaagctttagaggga
gatctggtgaaagtctcaggtgtagtaggcatagatgattttgaggttatgaaggttgtt
gggaaaggtgcgtttgggaaagtctaccaggtgaggaaaaaggagacctctgagatatac
gctatgaaagtcatgaggaaagatcacattatggagaagaaccatgctgaatacatgaaa
gctgagcgcgatattcttacaaaaattgatcacccattcattgttcaacttaaatactct
tttcagaccaagtacaggctgtatcttgtgctcgactttataaacggaggtcatcttttc
ttccaactctatcaccaagggcttttcagagaggacttggctcgagtgtacactgcagaa
atcgtctctgcagtttcccatctccatgagaaaggcataatgcacagagatctgaaaccc
gaaaacatactcatggatacagatggccacgtgatgctaacagattttggtttagcaaag
gaatttgaagaaaacacaagatcaaactccatgtgcggaactacggagtatatggcacct
gaaattgttcgaggaaaaggacatgataaagcagctgactggtggagcgtagggattctt
ctgtatgagatgctcacaggaaagccaccgtttctcgggagcaaaggaaagatacagcag
aaaattgtgaaggacaagatcaagcttccgcagtttctgtctaatgaagctcatgcaata
ctgaaagggctgctgcaaaaagagccagaaaggcgacttggaagtggactgagcggagca
gaggagataaaacagcacaaatggttcaagggaataaactggaagaagctggaggctaga
gaagtgatgccaagtttcaagccggaagtatcgggaaggcaatgcatagcaaattttgac
aagtgttggactgacatgtctgttttggattctccggcgagcagtcccagttcggatcct
aaggccaacccttttaccaatttcacttacgtcaggcctcctccttcattccttcaccag
tccacaactactttgtag

DBGET integrated database retrieval system