KEGG   Arabidopsis thaliana (thale cress): AT3G08850Help
Entry
AT3G08850         CDS       T00041                                 

Gene name
RAPTOR1
Definition
Regulatory-associated protein of TOR 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 1344 aa AA seqDB search
MALGDLMVSRFSQSSVSLVSNHRYDEDCVSSHDDGDSRRKDSEAKSSSSYGNGTTEGAAT
ATSMAYLPQTIVLCELRHDASEASAPLGTSEIVLVPKWRLKERMKTGCVALVLCLNITVD
PPDVIKISPCARIEAWIDPFSMAPPKALETIGKNLSTQYERWQPRARYKVQLDPTVDEVR
KLCLTCRKYAKTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPISELDSWLKTPSI
YVFDCSAARMILNAFAELHDWGSSGSSGSSRDCILLAACDVHETLPQSVEFPADVFTSCL
TTPIKMALKWFCRRSLLKEIIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLP
HELFQRLFRQDLLVASLFRNFLLAERIMRSANCNPISHPMLPPTHQHHMWDAWDMAAEIC
LSQLPQLVLDPSTEFQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFR
ALVLLGRFLDMGSWAVDLALSVGIFPYVLKLLQTTTNELRQILVFIWTKILALDKSCQID
LVKDGGHTYFIRFLDSSGAFPEQRAMAAFVLAVIVDGHRRGQEACLEANLIGVCLGHLEA
SRPSDPQPEPLFLQWLCLCLGKLWEDFMEAQIMGREANAFEKLAPLLSEPQPEVRAAAVF
ALGTLLDIGFDSNKSVVEDEFDDDEKIRAEDAIIKSLLDVVSDGSPLVRAEVAVALARFA
FGHKQHLKLAAASYWKPQSSSLLTSLPSIAKFHDPGSATIVSLHMSPLTRASTDSQPVAR
ESRISSSPLGSSGLMQGSPLSDDSSLHSDSGMMHDSVSNGAVHQPRLLDNAVYSQCVRAM
FALAKDPSPRIASLGRRVLSIIGIEQVVAKPSKPTGRPGEAATTSHTPLAGLARSSSWFD
MHAGNLPLSFRTPPVSPPRTNYLSGLRRVCSLEFRPHLLGSPDSGLADPLLGASGSERSL
LPLSTIYGWSCGHFSKPLLGGADASQEIAAKREEKEKFALEHIAKCQHSSISKLNNNPIA
NWDTRFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGFDNHDFPDKGISKLCL
INELDDSLLLVASCDGSVRIWKNYATKGKQKLVTGFSSIQGHKPGARDLNAVVDWQQQSG
YLYASGETSTVTLWDLEKEQLVRSVPSESECGVTALSASQVHGGQLAAGFADGSLRLYDV
RSPEPLVCATRPHQKVERVVGLSFQPGLDPAKVVSASQAGDIQFLDLRTTRDTYLTIDAH
RGSLTALAVHRHAPIIASGSAKQLIKVFSLQGEQLGIIRYYPSFMAQKIGSVSCLTFHPY
QVLLAAGAADSFVSIYTHDNSQAR
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atggcattaggagacttaatggtgtctcggttctcgcaatcttctgtttctttggtctcc
aatcaccgttacgacgaagactgtgtctctagtcacgatgacggtgattcccggaggaag
gattctgaggctaagagcagtagtagctacgggaatggtacaacggagggagccgccacc
gccaccagcatggcttacttgcctcagactattgtgctctgcgagcttagacacgacgca
tccgaggcttctgctcccttggggacttctgagatcgtattggtccccaaatggcggctt
aaagaacgaatgaaaacaggatgtgtagctttagttctgtgtttaaacattactgttgat
ccgccggatgttataaagatatctccttgtgctagaatcgaggcatggatagatccattt
tctatggcaccgcctaaagctctcgagacaattggaaaaaatttgagcactcagtatgag
agatggcaacccagggcccgctataaggttcagcttgatccgacagtagatgaggtgagg
aagctgtgcttgacttgtcggaaatatgcaaagaccgagagagttctattccattataat
gggcatggtgtgccaaaacctacagctaatggtgaaatttgggtatttaacaagagttat
acacagtacattcccttgccaatcagtgaacttgattcctggttgaagacaccctccatc
tatgttttcgactgctctgctgctaggatgattctgaatgcctttgctgagcttcatgat
tggggttcttctggttcctctggatcctcaagggactgcattctacttgctgcttgtgat
gtacatgagacacttcctcagagcgttgagtttccagctgatgtttttacgtcttgcctg
acaacgcccattaaaatggcgttgaaatggttctgcaggcgttcgcttctgaaagaaatt
atcgatgaatcacttatcgacaggattccaggccggcaaaacgatcgtaagacattgtta
ggggagttgaactggattttcacagcagtgacggatacaattgcttggaatgtgcttcct
catgaacttttccagagattattcagacaggacttgttggtcgctagccttttccggaat
ttcttacttgctgagagaataatgcggtccgcaaactgtaatccaatatctcaccctatg
ctgcctcctacgcatcaacatcatatgtgggatgcatgggacatggctgctgaaatctgt
ctttctcagcttccccaacttgttctggacccaagcacagagttccagccaagtccgttt
tttactgagcaactgacagcttttgaggtgtggcttgatcatggatctgagcataagaag
ccaccggagcagttacctattgttcttcaggtgttacttagccagtgccatcggtttcgt
gctcttgtacttcttggaagatttcttgatatgggttcatgggctgtggatctggccttg
tctgttggaatattcccatatgtgctgaagcttctgcaaacaacaacgaatgagctaaga
cagatcctggttttcatatggacaaaaattcttgcacttgacaagtcatgtcaaattgat
cttgtgaaggatggggggcatacatacttcatacgatttctagatagctcgggtgcattt
ccagaacaacgagctatggctgcttttgttctggctgtcattgtggatggacatcgacga
ggccaggaagcatgtcttgaagctaatttaattggtgtttgtctcgggcaccttgaagca
tccagaccaagtgatccacaaccagaaccattgtttctacaatggctttgtctttgtctt
ggaaagttatgggaagattttatggaggcccaaataatgggcagggaggcaaatgctttt
gaaaagttggcacctctgctttccgagccccaacctgaggtaagggctgctgcagttttt
gccctgggtaccttgcttgatattgggtttgactctaataaaagtgtggtggaggatgaa
tttgatgatgatgaaaagattagagccgaagacgctatcattaaaagtctcttagatgta
gtttcagatgggagtccacttgtccgagcagaggttgccgtagctcttgcacgttttgcc
tttggccacaaacagcaccttaagttagccgcagcttcatattggaagcctcagtcaagt
tctttgcttacttctctaccttcaatagctaaattccatgatcctgggagtgcaacaatt
gtttctttacacatgagtcctctgactagagctagcacggatagccaaccagtggctcgt
gagtctaggatctcaagcagccctcttggctcctctgggctgatgcaaggatctccatta
tctgatgattcttcgttacattctgattctggaatgatgcatgacagtgtcagcaatgga
gcggtccatcagccaagactgttggataatgctgtttattcgcagtgcgtccgagctatg
tttgcattagctaaagatccatctccacgtattgcaagtctcggacggcgtgtgctttct
attattggaatcgaacaggttgttgcgaaaccctcgaagcccactggccgaccaggggaa
gctgcaacgacatctcacactccacttgctggcctagctcgttcatcctcatggtttgat
atgcatgcaggtaatctgcctttaagttttaggactcccccggtcagcccccctagaaca
aactacctgagtggattgaggagagtttgttcattagagttcaggcctcatctattgggt
tcacccgactcaggattggctgatccgcttttaggcgccagtggatctgaacggagtttg
cttccactatcaactatctacggctggagttgtgggcacttttctaagccacttcttggt
ggtgcggatgctagtcaagagattgcagccaaaagagaagagaaagaaaaattcgcactt
gagcatattgcaaaatgccagcactcttctattagcaagctcaacaataatcctattgcc
aactgggatacaaggtttgaaacgggaacaaagacagccctccttcacccattctctcct
attgtagttgctgcagacgagaatgaacggatcagagtgtggaactatgaggaagcaact
cttctcaatggctttgacaatcatgattttcctgacaaaggaatttcaaagctctgcctc
atcaatgaacttgacgactctctgctacttgttgcatcatgcgatgggtcggtccggata
tggaaaaactatgcaactaagggtaaacaaaagcttgttactgggttttcttcaatccag
ggtcacaagcccggtgcccgtgacttgaacgctgtcgtggactggcaacaacagtccggt
tacctgtatgcttctggggagacgtcaacagtcacactttgggacctggagaaagaacag
cttgtcagatctgttccctctgaatcagaatgtggagttacagcactttctgcttctcaa
gtgcacggaggccaactcgctgctggttttgctgatggatctttgagactctatgatgtt
cggtcacctgaaccgcttgtctgcgcgactcggcctcatcagaaagttgaaagggtggtt
ggcctcagttttcaacctggacttgaccccgcaaaggtggtgagtgcatcacaggcgggt
gacatacagtttcttgaccttagaacaacaagggacacatacctgacgattgatgcacac
aggggttcactcacggccttagctgttcacagacacgctccaataatcgcgagtggatct
gcaaaacagctcattaaagtattcagtcttcaaggggaacaactagggataatccgctac
tacccatccttcatggctcaaaagattggatcagtgagttgcctcacatttcatccgtac
caggttctgctagcagctggagctgctgactcatttgtctccatatacacccacgacaac
tcgcaagcaagatga

DBGET integrated database retrieval system