KEGG   Arabidopsis thaliana (thale cress): AT3G09100Help
Entry
AT3G09100         CDS       T00041                                 

Definition
(RefSeq) mRNA capping enzyme family protein
  KO
K13917  
mRNA-capping enzyme [EC:2.7.7.50 3.6.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    AT3G09100
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.50  mRNA guanylyltransferase
     AT3G09100
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     AT3G09100
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     AT3G09100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 471 aa AA seqDB search
MVATMDLNASPQPEEDDEPYVRHLEDYSSRDERIESAVEIARREREERKKRMRYDKPTHN
SQPVFRDQYYQNRNTKAYDRYKIPQGWLDCPPSGNEIGFLVPSKVPLNESYNNHVPPGSR
YSFKQVIHNQRIAGRKLGLVIDLTNTTRYYSTTDLKKEGIKHVKIACKGRDAVPDNVSVN
AFVNEVNQFVLNLKHSKKYILVHCTHGHNRTGFMIVHYLMRSGPMNVTQALKIFSDARPP
GIYKPDYIDALYSFYHEIKPESVICPSTPEWKRSTELDLNGEALPDDEDDDGGPAGPVQG
FQEESHQVDVKMSNDDVLGDEIPPDQEEGYRQFFYRMLSLNIGGRGCSQFPGSHPVSLNR
ENLQLLRQRYYYATWKADGTRYMMLLTTDGCYIVDRSFRFRRVQMRFPFRHPTEGISDKV
HHFTLLDGEMIIDTLPDKQKQERRYLIYDMVAINGQSVVEVGIVIIYLCNQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggttgctacgatggacttaaatgcttcaccccaacccgaagaagatgacgaaccgtat
gtgagacatctagaagactattcttctcgggatgaacggatagagtctgctgttgaaatc
gctagacgggaacgtgaagagagaaagaaacgaatgagatatgacaagccaacacataac
tctcagccagttttccgtgatcaatattaccagaatcgaaatactaaagcttatgataga
tacaagatccctcaaggttggctagactgccctccttctgggaatgagataggattcctc
gttccttcaaaagttcccctgaatgaatcttacaataatcatgtacctcctggaagtaga
tactcttttaaacaggtgatccataaccagaggatagctgggagaaagcttggtctggtg
atcgatttgacaaacacaactcgttactattctacgacagacttgaagaaagaaggcatt
aagcatgtgaagattgcatgcaagggtcgtgatgcagtgccagataatgtgtctgtcaac
gcatttgtcaatgaggttaatcagtttgtcctaaatctaaaacactcgaaaaagtatatt
ctcgtccattgtacacatggacataatcggacagggttcatgatagttcattatctcatg
cgatctgggccaatgaatgttacacaggctttgaaaatcttttccgatgcccgcccacct
gggatctataaaccagattatattgatgctttatactcgttttatcacgaaataaaacct
gaaagcgtcatttgcccatcaactcctgaatggaagaggtctactgagcttgatttaaat
ggtgaagctttgccagatgatgaagatgatgatggcggtcctgctggtcctgtgcaaggt
ttccaggaggaaagtcatcaggtggatgtcaagatgtcaaatgatgacgttctaggtgat
gaaatacccccagaccaggaggaaggttaccgccaattcttttataggatgctatcactg
aatattgggggaagaggatgttcacaatttccaggttcacaccctgtctccttaaacagg
gaaaatttgcaactcttgaggcagcggtactattatgcaacatggaaagctgatggaacg
cgatatatgatgctgctaaccaccgatggatgttacatagtagatagaagctttagattc
cggagggtacagatgcggttcccctttaggcacccaactgaaggcatatctgataaagtg
caccatttcacattacttgatggagaaatgataatcgataccttgccagataaacaaaag
caggagaggagatacctaatctatgacatggtagcaatcaacggccaatcagttgtagag
gttggaattgtcattatttatttatgtaatcaataa

DBGET integrated database retrieval system