KEGG   Arabidopsis thaliana (thale cress): AT3G10330Help
Entry
AT3G10330         CDS       T00041                                 

Definition
transcription initiation factor IIB-2
Orthology
K03124  
transcription initiation factor TFIIB
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Basal transcription factors
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ath03022]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 312 aa AA seqDB search
MSDAFCSDCKRHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG
GPTNPLLADGGLTTVISKPNGSSGDFLSSSLGRWQNRGSNPDRGLIVAFKTIATMADRLG
LVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGATK
KEIGRAKEYIVKQLGLETGQLVEMGTIHAGDFMRRFCSNLGMTNQTVKAAQESVQKSEEF
DIRRSPISIAAAVIYIITQLSDEKKPLRDISVATGVAEGTIRNSYKDLYPHLSKIIPAWY
AKEEDLKNLQSP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcgttttgttcggactgtaagaggcacacggaggttgtgtttgaccattcc
gccggagatacagtttgttcagagtgtggtctcgtgcttgaatctcactcaatcgatgaa
acttctgagtggcgtactttcgctaatgagtccggtgataatgatcctgttcgtgtcggt
ggtccgacgaatcctcttttagcagatggtggtctcactactgtcatttctaaacctaat
ggatcctctggcgatttcctctcttcttctcttggtcgatggcagaatcgtggatctaat
cctgatcgtggccttattgttgctttcaagactatcgctaccatggctgataggttggga
cttgttgcgaccatcaaggaccgagcgaatgagatttataaaagggtagaggatcagaag
tcaagtagaggaagaaatcaggatgctcttttggctgcttgtttatacattgcttgccgg
caagaagacaaaccacggacggtcaaggaaatatgctctgttgccaatggagctactaag
aaggagattggtcgtgcaaaagagtacatagtcaaacagttggggctggaaaccggacaa
ttggttgaaatgggtactatacatgctggagattttatgagacgtttttgctccaatctt
ggtatgaccaaccaaaccgtgaaagcggctcaagagtctgtgcaaaagtcagaagaattt
gatataaggaggagtcccatatcgattgcagcagcggttatatacatcataacacagctc
tctgatgagaagaagcctcttcgagatatatcagtggcaactggagtcgcggaaggaact
ataagaaactcttacaaagatctttaccctcacctttccaagatcataccagcttggtac
gctaaagaagaagatctcaagaaccttcaaagcccttga

DBGET integrated database retrieval system