KEGG   Arabidopsis thaliana (thale cress): AT3G11910Help
Entry
AT3G11910         CDS       T00041                                 

Gene name
UBP13
Definition
ubiquitin carboxyl-terminal hydrolase 13
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT3G11910 (UBP13)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT3G11910 (UBP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 1114 aa AA seqDB search
MTMMTPPPLDQEDEEMLVPNPDLVEGPQPMEVAQTDPAATAVENPPPEDPPSLKFTWTIP
MFTRLNTRKHYSDVFVVGGYKWRILIFPKGNNVDHLSMYLDVADAANLPYGWSRYSQFSL
AVVNQVNNRYSIRKETQHQFNARESDWGFTSFMPLSELYEPTRGYLVNDTVLIEAEVAVR
KVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPTASI
PLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTVV
EGTIQKLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCKDVYASFDKYVEVERLEGD
NKYHAEGHDLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLQLDLDRE
DGRYLSPDADKSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKEDVK
RALEEQYGGEEELPQNNPGFNNPPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAEHL
RVRLKKEQEEKEDKRKYKAQAHLFTTIKVARDDDITEQIGKNIYFDLVDHEKVRSFRIQK
QTPFQQFKEEVAKEFGVPVQLQRFWIWAKRQNHTYRPNRPLSPNEELQTVGQIREASNKA
NNAELKLFLEIERGPDDLPIPPPEKTSEDILLFFKLYDPENAVLRYVGRLMVKSSSKPMD
IVGQLNKMAGFAPDEEIELFEEIKFEPCVMCEQIDKKTSFRLCQIEDGDIICYQKPLSIE
ESEFRYPDVPSFLEYVQNRELVRFRTLEKPKEDEFTMELSKLHTYDDVVERVAEKLGLDD
PSKLRLTSHNCYSQQPKPQPIKYRGVDHLSDMLVHYNQTSDILYYEVLDIPLPELQGLKT
LKVAFHSATKDEVIIHNIRLPKQSTVGDVINELKTKVELSHQDAELRLLEVFFHKIYKIF
PSTERIENINDQYWTLRAEEIPEEEKNIGPNDRLIHVYHFTKEAGQNQQVQNFGEPFFLV
IHEGETLEEIKTRIQKKLHVPDEDFAKWKFASFSMGRPDYLLDTDVVYNRFQRRDVYGAW
EQYLGLEHIDNAPKRAYAANQNRHAYEKPVKIYN
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgactatgatgactccgccgccgctagatcaggaagacgaggagatgcttgttccgaat
ccggatttggtcgagggacctcagcctatggaagttgcccaaactgatcctgctgctacc
gctgtggagaatccaccacccgaggatcctccaagtctgaaattcacgtggaccatccca
atgttcactaggctcaataccaggaagcattactctgacgtatttgttgtaggcggttat
aagtggcgtatattgatttttcccaaaggaaacaatgtcgaccatttgtcaatgtacttg
gatgttgctgatgctgcgaatttgccgtacgggtggagcagatattcacagttcagtctg
gctgtagtgaatcaagtcaacaaccgatattccatcagaaaggagacgcaacatcaattc
aatgcaagagaaagcgactgggggtttacatcattcatgcctctcagcgagctctatgaa
cccactcgaggatatttagtgaatgacactgttctgattgaagctgaagttgctgtgcgt
aaagttcttgattattggtcatatgactcaaaaaaagagacaggttttgttggactaaaa
aaccaaggtgctacctgttacatgaattctctcctgcagactttataccacataccttac
tttagaaaggctgtttaccacatgccaacgactgaaaatgatgcacctaccgctagtatc
ccattggcgctccagagtttattttacaagcttcagtataatgataccagtgtagcgaca
aaggagctgacaaagtcgtttggttgggatacatatgattcttttatgcaacatgatgta
caagaactcaacagagttctctgtgaaaagcttgaggacaagatgaagggaactgttgtg
gagggaacaatacaaaagctatttgaaggtcaccacatgaattacattgagtgcattaat
gtagattacaaatctacacggaaagagtcattttatgacctccagcttgatgttaaaggc
tgcaaagatgtatatgcttcttttgacaagtatgttgaagttgaacgccttgaaggagac
aacaaataccatgcagaaggacatgatttgcaggatgcaaaaaaaggtgttctattcata
gactttccaccagttcttcaacttcagctcaagaggtttgaatacgattttatgagggac
acaatggtgaagattaatgatcggtatgagtttcctctccaactggatctcgacagagaa
gatggaagatatttatcccctgatgcagacaagagtgtccgcaatctctacaccctccac
agtgtcttggttcacagtggaggagtgcatggagggcattattatgcttttattaggcca
acactttcagatcagtggtataaatttgacgatgaacgggtcacgaaagaagatgtcaaa
agagcactggaagagcaatatggtggtgaagaagagttaccgcagaataatcctggtttc
aataatccacctttcaaattcacaaaatactcgaatgcatacatgcttgtttatattcgg
gaaagtgacaaggataagataatctgcaacgttgatgagaaagacattgcggaacatttg
cgggtgaggctgaaaaaagaacaagaagaaaaggaagataaaagaaaatacaaggctcaa
gctcaccttttcacgacaatcaaggtcgcaagagatgatgacatcactgagcaaattgga
aagaatatatattttgatcttgttgatcatgaaaaagtgaggagttttcgaatccagaaa
cagaccccctttcaacaatttaaggaagaggtagccaaagagtttggtgtcccggttcaa
ctacagcggttctggatctgggcaaagcgtcaaaaccatacttaccgccccaatcgtccc
ctatcacctaatgaagaattacagacggttggacaaatacgagaggcatctaacaaggca
aacaatgctgagctaaagctgtttttggaaatagagcgtggaccggatgaccttcctatt
cctcccccagaaaaaacttctgaggatatccttcttttctttaaactctatgaccctgag
aacgcagtactaagatatgttggcaggctaatggtgaaaagttccagtaagcccatggat
atagtagggcaattgaataaaatggctggttttgctcctgatgaggaaatagaacttttt
gaggaaataaagtttgaaccttgcgtaatgtgtgaacagattgataagaagacttctttc
aggctgtgtcaaattgaagatggagatatcatttgttatcagaaacctctttctatcgag
gagagtgaatttcgatacccagatgtgccatcatttttggagtatgtacagaatcgagag
ctggtgcgttttcgcacactggaaaaaccaaaagaggatgagtttactatggagctgtca
aagctgcacacttatgatgatgtagtggaaagggtggctgagaagcttggccttgacgat
ccatcaaaacttaggcttacatctcacaattgctactctcagcaacccaagcctcagcca
atcaaataccgtggagtagatcatctttcagatatgttagttcactataatcagacgtct
gacatattgtattatgaagttttggatattcctcttccagaattgcaaggtcttaagact
ctaaaagtagctttccatagtgccacaaaggatgaagtgataatccacaatatcagacta
cctaagcagagtactgttggagatgttattaacgaactgaaaacaaaggtggagctttcg
catcaagatgcagaactgaggttacttgaggtctttttccacaagatctacaagatcttt
ccatctactgaacgaattgaaaacatcaatgaccagtactggactttacgagcagaggag
atacctgaagaagagaagaatattggtcccaatgataggttaattcacgtatatcatttt
actaaagaggccggacaaaatcagcaagttcaaaattttggggaacccttctttttggta
atccacgaaggtgaaactttagaagaaatcaagacccgtatccaaaagaaactccatgtc
cctgatgaggactttgccaagtggaagtttgcatcgttttcaatgggacgtcctgattac
ttgctggacacagatgttgtttataatcgctttcagagaagagatgtatacggtgcgtgg
gagcagtatcttgggttggagcacattgataatgctcctaaaagggcttatgctgcaaat
cagaaccgacacgcatacgagaagccggtgaaaatatacaattag

DBGET integrated database retrieval system