KEGG   Arabidopsis thaliana (thale cress): AT3G12280Help
Entry
AT3G12280         CDS       T00041                                 

Gene name
RBR1
Definition
(RefSeq) Retinoblastoma-related protein 1
  KO
K04681  
retinoblastoma-like protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Module
Cell cycle - G1/S transition
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    AT3G12280 (RBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 1013 aa AA seqDB search
MEEVQPPVTPPIEPNGKRSEASLLDICEKVLSLDGSTCDEALKLFTETKRILSASMSNIG
SGTREEVERFWFAFILYSVKRLSVRKEADGLSVSGDNEFNLCQILRALKLNIVDFFKELP
QFVVKAGSVLGELYGADWENRLQAKEVQANFVHLSLLSKYYKRGFREFFLTYDANAEKNS
ANSSTYLLDSYRFGWLLFLALRNHAFSRFKDLVTCSNGVVSILAILIIHVPCRFRNFSIQ
DSSRFVKKGDKGVDLVASLCKIYDASEDELRIVIDKANNLVETILKKKPSPASECQTDKL
DNIDPDGLTYFEDLLEETSISTSLITLEKDYYDGKGELDERVFINEEDSLLGSGSLSAGA
VNITGVKRKIDALSSPARTFISPLSPHKSPAAKTNGISGATKLAATPVSTAMTTAKWLRT
VISPLLPKPSPGLEHFLKSCDRDITNDVTRRAHIILEAIFPNSSLGAQCGGGSLQAVDLM
DDIWAEQRRLEACKLYYRVLEAMCKAEAQILHANNLNSLLTNERFHRCMLACSAELVLAT
HKTITMLFPAVLERTGITAFDLSKVIESFIRHEDSLPRELRRHLNSLEERLLESMVWEKG
SSMYNSLIVARPSLALEINQLGLLAEPMPSLDAIAALINFSDGANHASSVQKHETCPGQN
GGIRSPKRLCTDYRSILVERNSFTSPVKDRLLALGNVKSKMLPPPLQSAFASPTRPNPGG
GGETCAETGINIFFTKINKLAAVRINGMVERLQLSQQIRESVYCFFQHVLAQRTSLLFSR
HIDQIILCCFYGVAKISQMSLTFREIIYNYRKQPQCKPLVFRSVYVDALQCRRQGRIGPD
HVDIITFYNEIFIPAVKPLLVELGPVRNDRAVEANNKPEGQCPGSPKVSVFPSVPDMSPK
KVSAVHNVYVSPLRGSKMDALISHSTKSYYACVGESTHAYQSPSKDLSAINNRLNNSSSN
RKRTLNFDAEAGMVSDSMVANSLNLQNQNQNQNGSDASSSGGAAPLKTEPTDS
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttcagcctccagtgaccccgcccattgaaccaaatgggaaaagaagcgaa
gcctctctcttggacatatgcgagaaagttctgtctcttgatgggagcacttgcgatgaa
gctttgaagttgtttacagaaaccaaacgaattttgtcagcaagcatgtctaacattgga
agtggaacgcgggaagaagtagagaggttctggtttgcgtttattctctattcagtgaag
aggcttagtgtgagaaaagaagcggatggtctgtcagtgtctggtgataatgagtttaat
ctatgtcagatactgagggctctgaagctaaatattgtggatttttttaaagagttacct
cagtttgtggtcaaggctggatctgtactgggtgaactttacggcgcagactgggagaac
agacttcaggcaaaggaggtgcaggctaactttgtgcatcttagccttctaagcaaatac
tacaaacgtgggttccgggaattctttttgacatatgatgcaaacgcagaaaagaactca
gcaaactcttctacctatttgctggatagttatcgttttggatggctactctttttggca
ctccgaaaccatgcgtttagtcgatttaaggacctcgtgacatgctcaaatggcgtagtt
tctatattggctattttgatcatacatgttccttgtcggtttagaaatttcagcatccaa
gattcttctcgctttgttaagaaaggtgacaaaggtgtagacttggttgcatcactttgc
aagatatatgacgcctcagaagatgagttgaggatagtaattgacaaggcaaataatttg
gtagaaaccatactgaagaaaaagccatctccagcatctgagtgccaaactgacaagcta
gataatattgacccagatggcttgacctactttgaggatttactggaagagacgtccatc
tcaactagcttaattacacttgaaaaggattactatgatggtaaaggcgaacttgatgag
agggtattcatcaatgaagaggatagcttacttggatctggaagcttatctgcaggagct
gttaatattactggtgttaagaggaaaattgatgctttgagctcacctgcaaggacattt
ataagcccactttctcctcataagtcgcctgctgctaagacaaatggtattagcggtgct
accaagttggcagcaacaccagtgagcacagcaatgacaactgccaagtggctcaggact
gtcatatccccgcttctgccaaaaccttctcctgggttggaacatttccttaaatcatgt
gatagggatataacaaatgacgtcacacgaagagcacacataatattggaagctattttc
ccaaatagttcccttggtgcccaatgtggaggtggaagtttgcaagctgttgacctgatg
gatgacatatgggcagagcagcgcagattagaagcttgtaagttatactacagagttctt
gaggcaatgtgtaaagcagaagctcagattttgcatgcaaataatctgaactctttattg
acaaatgagaggttccatagatgcatgcttgcttgctcagctgaattggtactggctacc
cacaaaacaattacaatgttgttcccagctgttctggagaggactgggatcacagccttt
gatctcagcaaggtaattgagagtttcatacgacatgaagattctctgcctagagagttg
agacgacatctgaattcactggaggaacggcttctagagagtatggtatgggagaaaggc
tcttcaatgtacaattctctgattgttgccaggccatcgcttgcattggagataaatcag
ctcggtttactagctgaaccaatgccatctctggatgcaatcgcagcacttattaatttc
tctgacggagcaaatcatgcatcatctgtacaaaagcatgaaacttgtccaggacaaaat
ggggggattagatcgcccaaaagattatgtactgattaccgcagcattctagttgaacgc
aattcctttacatcaccagtaaaggatcgtctgttggccttaggcaacgttaaatccaag
atgctgccacctccgttgcagtctgcatttgccagcccaacacggcccaacccaggaggt
ggaggagaaacttgtgcagaaactggaatcaatattttcttcacaaagattaataaattg
gctgctgtaagaatcaatggaatggtggaaagactacaactttcacagcaaataagggag
agtgtgtattgtttcttccaacatgtacttgctcagcggacttctcttttattcagtcga
cacattgaccagatcattctctgttgcttctacggagtggccaagatatcccaaatgagc
ctgactttcagggaaatcatatacaactaccggaagcaaccacagtgtaaaccattagtt
ttccgcagcgtttatgtggatgcgttacaatgtcgccgtcaagggagaatagggccagat
catgttgacatcatcacattctacaatgaaatatttattcctgccgtaaagccgctgctg
gtggagctaggtcctgtaagaaacgaccgggctgtggaagccaataataagcctgaaggt
caatgtcccggatcgccaaaggtgtctgtgtttccaagtgttccagacatgtcccctaaa
aaagtatctgcagtgcacaatgtttatgtttctcctcttcggggatcaaagatggatgct
cttatttcacacagtacaaagagttactatgcttgtgttggagagagtacacatgcttac
cagagcccttcaaaggacctatctgccatcaacaaccgcttgaacaacagcagcagcaac
cgcaagaggacgctaaactttgacgcagaagcagggatggtcagcgattccatggtagca
aatagccttaacctccaaaaccaaaatcaaaaccaaaatggaagcgatgcatcgtcctca
ggtggtgccgcaccccttaaaaccgagccaacagattcatag

DBGET integrated database retrieval system