KEGG   Arabidopsis thaliana (thale cress): AT3G12500Help
Entry
AT3G12500         CDS       T00041                                 

Gene name
HCHIB
Definition
(RefSeq) basic chitinase B
  KO
K20547  
basic endochitinase B [EC:3.2.1.14]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AT3G12500 (HCHIB)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     AT3G12500 (HCHIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 335 aa AA seqDB search
MPPQKENHRTLNKMKTNLFLFLIFSLLLSLSSAEQCGRQAGGALCPNGLCCSEFGWCGNT
EPYCKQPGCQSQCTPGGTPPGPTGDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFIT
AAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPASDY
CEPSATWPCASGKRYYGRGPMQLSWNYNYGLCGRAIGVDLLNNPDLVANDAVIAFKAAIW
FWMTAQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRI
GFYQRYCNIFGVNPGGNLDCYNQRSFVNGLLEAAI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcctccacaaaaagaaaaccatagaacattgaacaaaatgaagactaatctttttctc
tttctcatcttttcacttctcctatcattatcctcggccgagcaatgtggtcgccaagct
ggaggagcactctgccccaacggtctatgctgcagcgagttcggctggtgcggtaacacc
gaaccatactgtaagcagcctggctgccaaagccagtgcactcccggtggtactcctcct
ggacccaccggcgatctttcgggcatcatttcaagttctcagttcgatgatatgcttaag
cataggaatgatgccgcttgtcctgctagaggtttctacacttacaacgcctttatcacc
gctgcaaagtccttccccggttttggcaccaccggagacaccgccacgaggaagaaggag
gtcgccgccttcttcggccagacttcccatgaaactacaggtggatgggctacagcacca
gacggaccatattcatggggctactgtttcaagcaagaacagaatcctgcttcagactac
tgtgaaccgagcgccacgtggccatgcgcatctggcaaacgctactacggaagaggacca
atgcaactgtcgtggaactacaattacggtctatgcggtagagcaataggagttgactta
ctcaacaaccctgaccttgttgccaacgacgcagtgatcgctttcaaagccgcgatttgg
ttctggatgactgctcagcctcccaaaccgtcttgccatgccgtgatagccggccagtgg
cagccttcagacgccgaccgtgccgccgggagattaccgggttatggagtgattacgaac
atcattaacggtggattggagtgtggacgtggccaagacgggagagtcgccgatcgtata
gggttttatcagaggtattgtaacatatttggtgttaatcctggtggtaatcttgattgt
tacaaccaaagatccttcgttaacggcctcctcgaagctgctatttag

DBGET integrated database retrieval system