KEGG   Arabidopsis thaliana (thale cress): AT3G13740Help
Entry
AT3G13740         CDS       T00041                                 

Definition
(RefSeq) ribonuclease III family protein
  KO
K11145  
ribonuclease III family protein [EC:3.1.26.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     AT3G13740
Ribosome biogenesis [BR:ath03009]
 Prokaryotic Type
  rRNA processing factors
   AT3G13740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 241 aa AA seqDB search
MVILSASSTVRAALDTQPRLPYNPNAPRKVKKIPNGNSFLPPPSPAPSPGISISVADLLK
RPSSKEITVDVDDTYMGYETWSPSPPKLEKPRSVFNPASLAFIGDSIYELYARRHFLFPP
LSIEDYNDRVRAVYALLNKLVDDDFLTKEERDILRWGKNLGSARTRTRRRAGNAVYNKAS
SLETLIGYLYLTNGKRLEKIMEKLGFSSDSSTEIVIEETNPKPSESSNLPNFILNEQVVS
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggtgattttatcggcgagctccactgtgagagctgccttagatacacaacctagactt
ccctacaaccctaatgcgccgcgaaaagttaagaaaatccctaacggtaattcattctta
ccgccgccgtcacctgcaccgtctccaggaatcagcatctccgtcgccgatttgctcaag
cgtccttcaagtaaagagataactgttgacgttgatgatacttatatgggatatgagaca
tggtctccaagtccaccaaagttggagaaaccaagatcagtcttcaatcctgcttcttta
gcctttataggcgattccatttatgagctatatgctcgtaggcattttcttttccctccg
cttagtattgaagattataacgatcgtgttagagctgtgtatgctttgctgaataaactt
gttgatgatgactttctaacaaaggaagagagggatattcttaggtggggaaagaatcta
ggttctgctagaacacgtacaagaaggcgtgcaggtaatgcggtttataacaaggcatca
tcattggaaacactaattggttatctgtatctgacaaacgggaaaagattagaaaaaata
atggagaagctaggattctcaagtgattcttcaactgagatcgtgattgaagaaaccaac
cctaaaccatcagaatcatccaacctgccaaacttcatactcaacgagcaagtggtgtca
ttttag

DBGET integrated database retrieval system