KEGG   Arabidopsis thaliana (thale cress): AT3G13930Help
Entry
AT3G13930         CDS       T00041                                 

Definition
(RefSeq) Dihydrolipoamide acetyltransferase, long form protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00020  Citrate cycle (TCA cycle)
ath00620  Pyruvate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G13930
   00020 Citrate cycle (TCA cycle)
    AT3G13930
   00620 Pyruvate metabolism
    AT3G13930
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AT3G13930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding CCDC71L Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 820606
NCBI-ProteinID: NP_566470
MIPS: AT3G13930.1
TAIR: AT3G13930
Araport: AT3G13930
UniProt: Q8RWN9
Position
3
AA seq 539 aa AA seqDB search
MASRIINHSKKLKHVSALLRRDHAVAVRCFSNSTHPSLVGREDIFKARLNYSSVERISKC
GTGNVTMLSGISTTSTKLSSPMAGPKLFKEFISSQMRSVRGFSSSSDLPPHQEIGMPSLS
PTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGFLAKIVKEEGAKEIQVG
EVIAITVEDEDDIQKFKDYTPSSDTGPAAPEAKPAPSLPKEEKVEKPASAPEAKISKPSS
APSEDRIFASPLARKLAEDNNVPLSSIKGTGPEGRIVKADVEDFLASGSKETTAKPSKQV
DSKVPALDYVDIPHTQIRKVTASRLAFSKQTIPHYYLTVDTCVDKMMGLRSQLNSFQEAS
GGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFKNVNINVAVQTENGLYVPVVKDA
DKKGLSTIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAVINPPQAAIL
AIGSAEKRVVPGTGPDQYNVASYMSVTLSCDHRVIDGAIGAEWLKAFKGYIETPESMLL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgtatcatcaatcattccaaaaagttgaaacatgtttccgctttactgcgg
cgtgaccatgctgtggcagtccgctgtttctccaacagtacccacccctctctcgttgga
agagaagatatcttcaaggcccgcctgaattattcctctgtagagagaatttcaaaatgt
ggtactggcaatgtaacaatgcttagtggtatttcaacaacgagcacaaaactaagcagc
ccaatggcaggaccaaaactatttaaagaatttataagctcccagatgcgatcagtgaga
ggattttcatccagttcagatcttcctcctcatcaagagattggaatgccttctctttcg
ccaacaatgactgagggtaacattgccaggtggctgaagaaagaaggtgataaagttgct
cctggtgaagtgctttgtgaagttgaaactgacaaagcaacagtcgaaatggaatgcatg
gaagagggttttctcgccaagatagtaaaggaggagggggcaaaagaaattcaagttggg
gaggtgattgctatcacagttgaagatgaagatgatattcaaaagtttaaagattacaca
ccctcatccgatactggtcccgctgcgcctgaagcaaaaccagctccttccctaccaaag
gaagagaaggtagagaagccagccagtgctcctgaagccaagatctctaagccaagctca
gctccttcagaagatcgtatttttgccagtcctcttgcaagaaagttggctgaagataat
aatgtacctctctcaagcattaaaggcacaggtcctgaaggacggatagtgaaggctgat
gtcgaagatttcttagcttcaggcagtaaagaaactactgccaaaccttccaagcaagtg
gattcaaaggttccagctcttgactatgttgacatccctcacactcagatacgaaaggtc
acagcctcacgtttggcattctcaaagcaaactattcctcactactacttgaccgtggat
acatgtgttgacaaaatgatgggtcttaggagtcaactcaattcatttcaagaggcttcc
ggtgggaaaaggatatctgtaaatgatcttgttattaaggctgctgcactggctcttcga
aaagttcctcagtgcaatagttcatggacagatgaatacatccgccaatttaaaaatgtg
aacatcaatgtcgctgtacaaacagaaaatgggctctacgttcctgtggtcaaggacgcg
gacaagaaaggactgtctacaattggagaagaggttcgattcttggctcaaaaagcaaaa
gaaaacagcttgaagccggaagattatgagggaggaacattcacagtctccaacctgggg
ggaccttttggcatcaaacagttctgtgccgtcatcaatccacctcaagcagccattcta
gcaatcggatctgctgaaaagagagttgttcccggtactggtccagaccaatacaacgtt
gcttcatacatgtctgtaacactaagctgtgaccaccgcgtaatagatggtgcaattgga
gccgagtggctgaaagcattcaagggctacatcgagaccccagaatctatgttgctctaa

DBGET integrated database retrieval system