KEGG   Arabidopsis thaliana (thale cress): AT3G13930Help
Entry
AT3G13930         CDS       T00041                                 

Definition
dihydrolipoamide acetyltransferase, long form protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ath01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ath00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ath00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ath00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 539 aa AA seqDB search
MASRIINHSKKLKHVSALLRRDHAVAVRCFSNSTHPSLVGREDIFKARLNYSSVERISKC
GTGNVTMLSGISTTSTKLSSPMAGPKLFKEFISSQMRSVRGFSSSSDLPPHQEIGMPSLS
PTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGFLAKIVKEEGAKEIQVG
EVIAITVEDEDDIQKFKDYTPSSDTGPAAPEAKPAPSLPKEEKVEKPASAPEAKISKPSS
APSEDRIFASPLARKLAEDNNVPLSSIKGTGPEGRIVKADVEDFLASGSKETTAKPSKQV
DSKVPALDYVDIPHTQIRKVTASRLAFSKQTIPHYYLTVDTCVDKMMGLRSQLNSFQEAS
GGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFKNVNINVAVQTENGLYVPVVKDA
DKKGLSTIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAVINPPQAAIL
AIGSAEKRVVPGTGPDQYNVASYMSVTLSCDHRVIDGAIGAEWLKAFKGYIETPESMLL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgtatcatcaatcattccaaaaagttgaaacatgtttccgctttactgcgg
cgtgaccatgctgtggcagtccgctgtttctccaacagtacccacccctctctcgttgga
agagaagatatcttcaaggcccgcctgaattattcctctgtagagagaatttcaaaatgt
ggtactggcaatgtaacaatgcttagtggtatttcaacaacgagcacaaaactaagcagc
ccaatggcaggaccaaaactatttaaagaatttataagctcccagatgcgatcagtgaga
ggattttcatccagttcagatcttcctcctcatcaagagattggaatgccttctctttcg
ccaacaatgactgagggtaacattgccaggtggctgaagaaagaaggtgataaagttgct
cctggtgaagtgctttgtgaagttgaaactgacaaagcaacagtcgaaatggaatgcatg
gaagagggttttctcgccaagatagtaaaggaggagggggcaaaagaaattcaagttggg
gaggtgattgctatcacagttgaagatgaagatgatattcaaaagtttaaagattacaca
ccctcatccgatactggtcccgctgcgcctgaagcaaaaccagctccttccctaccaaag
gaagagaaggtagagaagccagccagtgctcctgaagccaagatctctaagccaagctca
gctccttcagaagatcgtatttttgccagtcctcttgcaagaaagttggctgaagataat
aatgtacctctctcaagcattaaaggcacaggtcctgaaggacggatagtgaaggctgat
gtcgaagatttcttagcttcaggcagtaaagaaactactgccaaaccttccaagcaagtg
gattcaaaggttccagctcttgactatgttgacatccctcacactcagatacgaaaggtc
acagcctcacgtttggcattctcaaagcaaactattcctcactactacttgaccgtggat
acatgtgttgacaaaatgatgggtcttaggagtcaactcaattcatttcaagaggcttcc
ggtgggaaaaggatatctgtaaatgatcttgttattaaggctgctgcactggctcttcga
aaagttcctcagtgcaatagttcatggacagatgaatacatccgccaatttaaaaatgtg
aacatcaatgtcgctgtacaaacagaaaatgggctctacgttcctgtggtcaaggacgcg
gacaagaaaggactgtctacaattggagaagaggttcgattcttggctcaaaaagcaaaa
gaaaacagcttgaagccggaagattatgagggaggaacattcacagtctccaacctgggg
ggaccttttggcatcaaacagttctgtgccgtcatcaatccacctcaagcagccattcta
gcaatcggatctgctgaaaagagagttgttcccggtactggtccagaccaatacaacgtt
gcttcatacatgtctgtaacactaagctgtgaccaccgcgtaatagatggtgcaattgga
gccgagtggctgaaagcattcaagggctacatcgagaccccagaatctatgttgctctaa

DBGET integrated database retrieval system