KEGG   Arabidopsis thaliana (thale cress): AT3G14310Help
Entry
AT3G14310         CDS       T00041                                 

Gene name
PME3
Definition
pectin methylesterase 3
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT3G14310 (PME3)
   00500 Starch and sucrose metabolism
    AT3G14310 (PME3)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AT3G14310 (PME3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 592 aa AA seqDB search
MAPSMKEIFSKDNFKKNKKLVLLSAAVALLFVAAVAGISAGASKANEKRTLSPSSHAVLR
SSCSSTRYPELCISAVVTAGGVELTSQKDVIEASVNLTITAVEHNYFTVKKLIKKRKGLT
PREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLISSAITNQETCLD
GFSHDDADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAKITSNNRKLKEE
NQETTVAVDIAGAGELDSEGWPTWLSAGDRRLLQGSGVKADATVAADGSGTFKTVAAAVA
AAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTIITGSRNVVDGSTTFHSA
TVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFF
VKCLIAGTVDFIFGNAAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIG
ATSDLQSVKGSFPTYLGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYS
NTGAGAGTANRVKWRGFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcaccatcaatgaaagaaattttttctaaagataatttcaagaaaaacaagaaactt
gttttgctatccgccgccgtagctttgctcttcgtagccgccgtcgccggaatctctgcc
ggagcttcaaaagccaacgaaaaacgaactctatccccgtcgtctcacgccgtgctaaga
tcctcatgcagctccacgcgttaccctgagctctgtatctctgccgtggtaactgccggc
ggcgtcgagctaacgtcgcaaaaagatgtcatcgaggcatcggtgaacctaacaataacc
gccgtggagcacaattacttcaccgtgaagaagctgatcaagaagaggaaaggactgacg
ccgcgcgagaagacggcgcttcatgactgtttggagactattgatgagacgctggacgag
ctccatgaaacggtggaagatctccatttgtatccaaccaaaaaaactctccgggaacac
gccggagatctcaaaacactaattagctccgccattaccaaccaggagacttgtctcgac
ggcttctctcatgacgacgccgataagcaagttcgtaaagccttgttgaaggggcagata
cacgtagagcacatgtgcagcaacgctctagcaatgatcaagaacatgactgatactgac
atagccaacttcgagcaaaaagctaaaataacctcaaacaaccgtaagctcaaggaggag
aatcaggaaactacggtggctgtagatatcgccggagccggagaactagactcggaggga
tggccaacttggttatccgctggagataggaggcttcttcagggttcaggtgtgaaagct
gacgccaccgtggcagctgacggtagcggtacatttaaaactgtggctgctgcggttgcc
gcggcccctgaaaatagtaataagaggtatgtgatacatataaaagccggagtttacaga
gagaatgtggaggttgctaagaagaaaaagaatataatgtttatgggagatggtcggacg
agaactattatcaccggaagtcgaaacgttgtagacggtagcaccactttccactccgcc
accgttgctgctgtcggcgagagattcttagctcgtgacatcactttccaaaacacggcg
ggtccgtcgaagcaccaagcggtggctctccgtgtgggttctgatttctccgccttctac
aattgcgacatgttagcttatcaagacactctatacgtccactctaaccgtcaattcttc
gtcaaatgtctcatcgccggaaccgttgacttcatcttcggaaacgccgccgtcgtgctc
caagactgtgacatccacgctcgccgccctaattccggtcagaaaaacatggtcacagct
cagggaagaacggatcctaaccagaacacagggatcgttatccagaaatgtaggatcggt
gccacgtcggatttacagtcggtgaaaggtagttttccgacgtacttgggtcggccatgg
aaggaatattcacaaacggtgataatgcagtcggctatctccgacgtgatccgacccgaa
gggtggtccgagtggaccgggacttttgcgttgaacactctgacttacagagagtattcg
aacacaggagcaggggctggaactgcaaatagagtgaagtggaggggctttaaggtaatt
acggctgctgctgaagctcaaaaatatacggctggtcagtttattggtggtggaggctgg
ttatcgtcgaccggtttccccttctcgctcggtctttga

DBGET integrated database retrieval system