KEGG   Arabidopsis thaliana (thale cress): AT3G15850Help
Entry
AT3G15850         CDS       T00041                                 

Gene name
FAD5
Definition
(RefSeq) palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
  KO
K20416  
palmitoyl-[glycerolipid] 7-desaturase [EC:1.14.19.42]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.42  palmitoyl-[glycerolipid] 7-desaturase
     AT3G15850 (FAD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 371 aa AA seqDB search
MASLLTKPKPVFLCSPSLSPRTLNTATPSLNFTRISFTHHQKLAPFKPPSLVVAFSEKGL
KRDVTTAAAATEGDYRRIMLSDVLVKKKEKVVWWEREWKAMDFGAVAVVLSMHLLSLLAP
FQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQGNPID
WVSTHRYHHQFCDSDRDPHSPLDGFWFSHMNWMFDTNTITQRCGEPNNVGDLEKQPFYRF
LRTTYILHPLALAVALYAMGGFPFIVWGMGVRIVWVYHITWLVNSACHVWGKQAWNTGDL
SKNNWWVAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVKFLQAIGLATDVKLPSE
AQKQRMAFTSD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcttctaacaaaacccaaacccgttttcctctgttcaccatcgttatctcca
agaactttgaacacagcaacaccgtcattgaatttcaccagaatttcattcacccatcac
caaaagcttgctcctttcaagcctcctagtctcgttgttgcattctctgaaaagggtttg
aagagagatgtcaccacagctgctgcagcgacggagggagattacagaaggataatgtta
tctgatgtgttggtgaagaagaaggaaaaagtagtttggtgggagagagaatggaaagct
atggactttggagctgttgctgtcgttttgtctatgcatttgcttagtcttttggctccg
tttcaattcaattggagagctgtttcggttgcttttgggctttatatcgttacaggtctt
ctggggattactctgtctttccataggaatctttctcataaagccttcaagctacctaaa
tggcttgagtacttgtttgcttattgtggagctcaagctcttcagggaaacccaattgat
tgggtgagtacacataggtaccatcatcagttttgtgattcagacagagaccctcatagc
ccacttgatgggttttggttcagtcacatgaattggatgtttgataccaatacaatcacc
caaaggtgtggagagcctaataatgttggggacttggagaagcagccattctatcgattc
cttcgaaccacctacattttgcatccgctggctctagcggttgctttatacgcaatgggt
ggctttccattcatcgtttggggaatgggtgtaagaatagtatgggtatatcatataact
tggctagtgaactcagcttgtcatgtatggggaaaacaagcatggaacacaggcgatttg
tctaagaacaactggtgggtagcagctctagcattcggggaaggatggcacaacaatcac
catgcttttgagttctcagctcgacacggcttagaatggtggcaacttgatatgacttgg
tacgtcgttaagttccttcaagccatcggtttagcaactgatgtcaagctcccatcggaa
gctcagaaacaaagaatggcattcaccagcgactga

DBGET integrated database retrieval system