KEGG   Arabidopsis thaliana (thale cress): AT3G15850Help
Entry
AT3G15850         CDS       T00041                                 

Gene name
FAD5
Definition
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ath01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ath01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 371 aa AA seqDB search
MASLLTKPKPVFLCSPSLSPRTLNTATPSLNFTRISFTHHQKLAPFKPPSLVVAFSEKGL
KRDVTTAAAATEGDYRRIMLSDVLVKKKEKVVWWEREWKAMDFGAVAVVLSMHLLSLLAP
FQFNWRAVSVAFGLYIVTGLLGITLSFHRNLSHKAFKLPKWLEYLFAYCGAQALQGNPID
WVSTHRYHHQFCDSDRDPHSPLDGFWFSHMNWMFDTNTITQRCGEPNNVGDLEKQPFYRF
LRTTYILHPLALAVALYAMGGFPFIVWGMGVRIVWVYHITWLVNSACHVWGKQAWNTGDL
SKNNWWVAALAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVKFLQAIGLATDVKLPSE
AQKQRMAFTSD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcttctaacaaaacccaaacccgttttcctctgttcaccatcgttatctcca
agaactttgaacacagcaacaccgtcattgaatttcaccagaatttcattcacccatcac
caaaagcttgctcctttcaagcctcctagtctcgttgttgcattctctgaaaagggtttg
aagagagatgtcaccacagctgctgcagcgacggagggagattacagaaggataatgtta
tctgatgtgttggtgaagaagaaggaaaaagtagtttggtgggagagagaatggaaagct
atggactttggagctgttgctgtcgttttgtctatgcatttgcttagtcttttggctccg
tttcaattcaattggagagctgtttcggttgcttttgggctttatatcgttacaggtctt
ctggggattactctgtctttccataggaatctttctcataaagccttcaagctacctaaa
tggcttgagtacttgtttgcttattgtggagctcaagctcttcagggaaacccaattgat
tgggtgagtacacataggtaccatcatcagttttgtgattcagacagagaccctcatagc
ccacttgatgggttttggttcagtcacatgaattggatgtttgataccaatacaatcacc
caaaggtgtggagagcctaataatgttggggacttggagaagcagccattctatcgattc
cttcgaaccacctacattttgcatccgctggctctagcggttgctttatacgcaatgggt
ggctttccattcatcgtttggggaatgggtgtaagaatagtatgggtatatcatataact
tggctagtgaactcagcttgtcatgtatggggaaaacaagcatggaacacaggcgatttg
tctaagaacaactggtgggtagcagctctagcattcggggaaggatggcacaacaatcac
catgcttttgagttctcagctcgacacggcttagaatggtggcaacttgatatgacttgg
tacgtcgttaagttccttcaagccatcggtttagcaactgatgtcaagctcccatcggaa
gctcagaaacaaagaatggcattcaccagcgactga

DBGET integrated database retrieval system