KEGG   Arabidopsis thaliana (thale cress): AT3G15870Help
Entry
AT3G15870         CDS       T00041                                 

Definition
(RefSeq) Fatty acid desaturase family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
3
AA seq 361 aa AA seqDB search
MMSLSTTLKPLSHFSPFVKRHNPKTNNTLFTLDTHNFTNSFWSKRGGSVSHRKHTVVAVY
EAPDHVESSWRRLLSEVVVVRTKRSFWERSWTSWDVSKLVIFVGTHLLSLLAPFYFSWEA
FWVFPWLVFINGICITLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQGDPIEWVSNHRYH
HKHCETQRDPHSPTQGFWFSHMAWIFDTSSILENCGGEENVDDLVRQPFYRFLQRTVLLH
MMAYSFLFYFCGGMPLLVWGIGITIAVRLHLTFLVNSVCHIWGTRAWNTSDFSKNNWWVA
ILTLGEGWHNNHHAFEFSARHGLEWWQLDITWCLIRFLEAIGLATNVKLPTETQMKGKAL
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctctatctacaactctcaaaccgctttctcatttttcaccttttgttaaaaga
cataaccccaaaactaacaataccttgttcacacttgacacacataactttacaaactct
ttttggtccaaacgaggaggatctgtgtctcacaggaaacacacggtcgtggctgtttat
gaggcaccggatcatgtcgagagctcatggagaagactcttgtcggaggttgtggtggtg
agaacgaagaggtcattttgggaaaggagttggacttcttgggacgtgagcaagttagta
atattcgtcgggactcatttgttgagcctcttggctccattttacttcagttgggaggct
ttttgggttttcccttggctcgttttcatcaatggaatctgcattaccttgtcttatcat
aggaacctttctcaccgaagttttgatctgccgaaatggctcgaatatctatttgcttac
ggtggcgttctggcttttcagggagacccaatagagtgggtgagcaaccatcggtaccat
cataagcattgtgagacacaacgtgacccacacagccctacacaagggttttggtttagt
cacatggcatggatatttgatacaagttctatccttgagaattgtggtggagaggagaat
gtagatgaccttgtgaggcagcccttctataggttccttcagcgaacggtcctattgcat
atgatggcttattccttcctcttctatttttgtggaggcatgcctttactcgtctgggga
attggtatcacaattgcggttcgacttcacctgacttttctggtgaactcagtttgtcat
atatggggaacacgagcatggaacacatctgacttctccaaaaacaattggtgggtagca
attttaacacttggcgagggatggcataacaatcatcatgcgttcgagttctcggccagg
catggactcgaatggtggcagctcgacattacttggtgtctcattagatttcttgaagct
attggtttggccactaacgttaagttacctactgaaactcaaatgaagggaaaggctttg
gtttga

DBGET integrated database retrieval system