KEGG   Arabidopsis thaliana (thale cress): AT3G15950Help
Entry
AT3G15950         CDS       T00041                                 

Gene name
NAI2
Definition
(RefSeq) TSK-associating protein 1-like protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 772 aa AA seqDB search
MGTKFLALGLSLCLVLSSFYQVSCQDEGTGSLSTLDLIEHEYQTSVNSLQGNEAVDQTET
SGQKNSTVSDNNTISLSLSEEPALETLKESVDTSAELGAVTDEVDKPSSMLDHIELEFEA
HINELKEAGSDGINKVEESKDDEEAARRHKMLEAIEREFEAAHAGFEQLKTDDSAQGLDD
EQSAKRQSMLDEIERDFEAATKGLEQLKADDLTGINDEEHAAKRQKMLEEIEREFEEATK
GLEELRHSTSSTDDEAQSAKRQNMLDEIEREFEAATSGLKELKINAHTVKDDVDDKEQDA
KRQSMLDAIEREFEAVTESFKQLEDIADNKAEGDDESAKRQSMLDEIEREFEAATNSLKQ
LNLDDFSEGDDSAESARRNSMLEAIEREFEAATKGLEELKANDSTGDKDDDEHVARRKIM
LEAIEREFEAATKGLEELKNESEQAENKRNSMLEAFEREFEAATNAKANGENSAKNPSTI
STTVQKSSGGYNAGLEGLLKPADGVCGCFNKDKDGLQADTDSSINIAEILAEESKLQGSG
TSRLTTSLNNLVDTHRKETSSKVGSVLGSSSSVTSTTSESAATSESIESLKQTLRKLRGL
SARDLVNHPNFDAIIAAGTRYEVLSSASIGYISLLAKYKTVIKEGLEASQRVQIAQTRAK
LLKETAMEKQRTVDSVFAAAKTTAQRGDALHIRIVAIKKLLAKLEAEKVDVDSKFTSLTT
SLSELLKEASQAYEEYHEAVHKAKDEQAAEEFAVETTKRAEHIWVEFLSSLN
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaaagtttttagctctgggtttgtctctgtgtcttgttctctcaagcttctat
caagtttcttgccaggatgaaggaactggaagtttgagtactttagatctaattgagcat
gaatatcaaactagtgtcaattctctccaaggcaatgaagcagtagatcaaactgagacc
agtggtcagaaaaacagtacagtgtctgataacaacactatttctttgtctctatctgaa
gaacctgcattggaaactcttaaagaatctgttgatacatcagctgagttaggagctgtt
actgatgaagtcgataaaccttcaagtatgttggaccatattgaacttgagttcgaagca
catatcaatgaacttaaagaagctggatctgatggtatcaacaaagttgaggaatctaaa
gatgatgaagaagctgcaaggagacataaaatgttggaagccattgaacgtgaatttgaa
gctgctcatgctggatttgaacaactaaagactgatgattccgcccaaggattagatgat
gaacaatctgcaaagagacaaagcatgttggacgagattgaacgtgattttgaagctgct
acaaaaggtcttgagcaactaaaggctgatgatttaactggaatcaacgatgaagaacac
gctgcaaagagacaaaagatgcttgaagagatcgaaagagagtttgaagaagctacaaaa
ggtcttgaagaactaaggcattctacctcaagcacagatgatgaagcacaatctgcaaag
agacagaatatgctagatgagatcgaacgggagtttgaagctgctacaagtggtcttaaa
gagctaaagattaatgctcacactgtcaaagatgatgttgatgataaagaacaagatgcc
aaaagacaaagtatgctagatgcaattgaacgtgagtttgaagccgttaccgagagtttt
aaacaacttgaagatatcgccgataacaaagctgaaggagacgacgaatctgcaaagagg
caaagtatgttggatgagattgaacgtgaatttgaagctgctacaaatagtcttaagcaa
ctaaaccttgacgatttcagtgaaggagatgacagtgcagaatctgcaaggagaaatagt
atgcttgaagctatcgaacgcgagtttgaagctgctacaaaaggtcttgaagagctaaag
gctaatgattcaaccggcgacaaggatgatgatgaacacgttgcaaggagaaaaattatg
cttgaagctattgaacgcgagtttgaagccgcgacaaaaggccttgaagagttaaagaat
gaatcagaacaagctgaaaacaagagaaacagtatgttggaagcattcgaacgcgaattt
gaagctgctacaaatgcaaaggctaatggagaaaactctgcaaagaatccatcaaccata
agtactacagtgcagaaatcttctggcggatacaatgctggtttagaaggtcttctaaag
cctgcagatggtgtatgtggttgtttcaacaaggataaagatggtcttcaggcagacact
gattcttcgattaacatagcggagatactcgcagaagaatccaaattacagggctcaggg
acctctcggctcaccacatcattgaacaatcttgttgatactcatagaaaagaaacgtcc
tcaaaggtaggctcagtccttggctcatcttcatcagttacttctaccacaagcgaatca
gcggctacatcagagagcatagagagcttaaagcaaacactaaggaagctacgcggtcta
agcgcacgtgatctcgtaaaccacccgaatttcgatgcgattatagcagccggtacacgt
tacgaggtactcagctcagcttctattggttacatctctttgctagccaaatacaaaacc
gtcattaaagaaggactcgaggcttctcagagagtccagattgctcaaacccgagccaaa
ctgctaaaagaaaccgcaatggagaagcagagaaccgtagactcggttttcgcagcagca
aagaccactgctcaaagaggagacgcgttgcacatcagaatcgtagcgatcaagaaactg
ttggcaaagctagaagcagagaaagtggacgttgattcaaagttcacctctttaacgacg
agtctgtcagagcttctcaaggaggcgtcacaggcttacgaagagtatcacgaggcggtg
cataaggcaaaggacgagcaagcggctgaggaatttgcggtggagacgacaaagagagca
gaacatatttgggttgagtttcttagttcacttaattga

DBGET integrated database retrieval system