KEGG   Arabidopsis thaliana (thale cress): AT3G16110Help
Entry
AT3G16110         CDS       T00041                                 

Gene name
PDIL1-6
Definition
protein PDI-like 1-6
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT3G16110 (PDIL1-6)
Enzymes [BR:ath01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AT3G16110 (PDIL1-6)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AT3G16110 (PDIL1-6)
  Exosomal proteins of colorectal cancer cells
   AT3G16110 (PDIL1-6)
  Exosomal proteins of bladder cancer cells
   AT3G16110 (PDIL1-6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 534 aa AA seqDB search
MLTKPKPNSKFSILFTFLLLLSFLIFVARSSDVAVEAGSEEELDDLEQLLAVDEQLQEER
PEQQSEAETVSKAQRIVVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATD
LKEIGSSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKK
TGASTIKLDTVDEASGFLKKHHTFILGLFEKSEDSSGHDEFVKAASLDNEIQFVETSSID
VAKLLFPNLKTNNVFVGLVKTEAEKYTSYDGPCQAEKIVEFLNSNKFPLVTKLTESNTVR
VYSSPVKLQVMVFSKTDDFESLAQPLEDIARKFKSKLMLIYIDISNENLAMPFLTLFGIE
DAKKTVVAAFDNNLNSKYLLESDPSPSNIEEFCFGLAHGTVSAYYKSQPIPDNQNASVVA
VVGRTFDEVVLRSSENVLLEVHTPWCINCEALSKQVEKLSQHFKGFENLVFARIDASANE
HPKLTVDDYPTILLYKTGEKENPLKLSTKSSAKDMAVLINKELKWKDQSGKDEL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgaaaccaaaacccaattccaaattttcaatcttgttcactttccttttgctc
ctcagtttcttaatcttcgttgctcgttcctctgatgtcgccgtcgaagccggatccgag
gaagaattagacgatctagagcagctccttgcggttgacgaacaattgcaggaagagaga
ccagagcaacaatctgaagcggagacggtgagcaaggcgcagcggatcgttgtggaactc
aacggagacaatacgaagcgattgattgatgggaatgagtatgtgatggttttaggttac
gcgccgtggtgtgcgaggagtgctgagctaatgccgagatttgcggaggcggcgacggat
ttgaaggaaattggtagttcggttttgatggcgaagattgacggcgagaggtattcgaaa
gtggcgtctcagcttgagattaaaggtttcccaacgcttcttctgtttgttaatggcaca
tctcagtcttacactggtggattttcctcagaggagatagtgatttgggtgcaaaagaag
actggtgcgtctactattaaacttgatacagttgatgaagcttcaggatttctgaagaag
catcatactttcattctcggtctattcgaaaagtctgaggattcttctggacatgatgaa
tttgtaaaagctgcgtcgttagacaatgaaatccagtttgtagaaacaagcagcattgat
gttgctaagcttctcttccctaaccttaaaaccaacaatgtgtttgttggattggttaaa
actgaggctgaaaagtatacttcatatgatggaccttgccaagccgagaagatagtggaa
tttctgaacagtaataaattccctttggttacaaaattgactgaatccaacaccgttcgt
gtttactccagtccagtcaagcttcaggttatggtcttttcgaagactgatgactttgaa
agtctagctcagcctctagaagatattgcaagaaagttcaaatcaaagcttatgttgata
tatattgacatatcaaacgaaaacctcgcaatgccattcttgacattattcgggatagaa
gatgcaaagaaaactgttgttgctgcattcgacaacaacctgaactccaagtatttgctt
gagtcggatccatctcctagcaatatagaagaattttgtttcggacttgctcatggaact
gtttcagcttactataagtcacagcctattccagataatcaaaatgcaagcgtagtggct
gtggtcggcaggacttttgatgaagtggtcttgaggagcagcgagaatgttcttcttgag
gtgcacacaccatggtgtattaactgtgaggctctgagtaaacaggttgagaagttgtcg
caacactttaaagggtttgaaaatcttgtctttgcaaggatagacgcttctgcaaacgag
catcctaagctaacggttgatgattacccgacaatcttgctttacaagactggtgaaaag
gagaatccgttaaagctttcgacgaaatccagtgcgaaggatatggctgttttaatcaac
aaagagttgaaatggaaggatcagtctggtaaagatgagttatag

DBGET integrated database retrieval system