KEGG   Arabidopsis thaliana (thale cress): AT3G16320Help
Entry
AT3G16320         CDS       T00041                                 

Gene name
CDC27a
Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04120  Ubiquitin mediated proteolysis
Module
ath_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AT3G16320 (CDC27a)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AT3G16320 (CDC27a)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     AT3G16320 (CDC27a)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    AT3G16320 (CDC27a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 ANAPC3 TPR_2 TPR_8 TPR_14 TPR_12 TPR_17 TPR_11 TPR_19 TPR_16 TPR_7 TPR_9 TPR_10 TPR_15 NARP1 SRP_TPR_like ChAPs
Motif
Other DBs
NCBI-GeneID: 820879
NCBI-ProteinID: NP_188253
MIPS: AT3G16320.1
TAIR: AT3G16320
Araport: AT3G16320
UniProt: Q06AN9
Position
3
AA seq 717 aa AA seqDB search
MMENLLANCVQKNLNHFMFTNAIFLCELLLAQFPSEVNLQLLARCYLSNSQAYSAYYILK
GSKTPQSRYLFAFSCFKLDLLGEAEAALLPCEDYAEEVPGGAAGHYLLGLIYRYSGRKNC
SIQQFRMALSFDPLCWEAYGELCSLGAAEEASTVFGNVASQRLQKTCVEQRISFSEGATI
DQITDSDKALKDTGLSQTEHIPGENQQDLKIMQQPGDIPPNTDRQLSTNGWDLNTPSPVL
LQVMDALPPLLLKNMRRPAVEGSLMSVHGVRVRRRNFFSEELSAEAQEESGRRRSARIAA
RKKNPMSQSFGKDSHWLHLSPSESNYAPSLSSMIGKCRIQSSKEATTSGQSVSDIGSSVD
DEEKSNPSESSPDRFSLISGISEVLSLLKILGDGHRHLHMYKCQEALLAYQKLSQKQYNT
HWVLMQVGKAYFELQDYFNADSSFTLAHQKYPYALEGMDTYSTVLYHLKEEMRLGYLAQE
LISVDRLSPESWCAVGNCYSLRKDHDTALKMFQRAIQLNERFTYAHTLCGHEFAALEEFE
DAERCYRKALGIDTRHYNAWYGLGMTYLRQEKFEFAQHQFQLALQINPRSSVIMCYYGIA
LHESKRNDEALMMMEKAVLTDAKNPLPKYYKAHILTSLGDYHKAQKVLEELKECAPQESS
VHASLGKIYNQLKQYDKAVLHFGIALDLSPSPSDAVKIKAYMERLILPDELVTEENL
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatggagaatctactggcgaattgtgtccagaaaaaccttaaccattttatgttcacc
aatgctatcttcctttgcgaacttcttctcgcccaatttccatctgaggtgaacctgcaa
ttgttagccaggtgttacttgagtaacagtcaagcttatagtgcatattatatccttaaa
ggttcaaaaacgcctcagtctcggtatttatttgcattctcatgctttaagttggatctt
cttggagaggctgaagctgcattgttgccctgtgaagattatgctgaagaagttcctggt
ggtgcagctgggcattatcttcttggtcttatatatagatattctgggaggaagaactgt
tcaatacaacagtttaggatggcattgtcatttgatccattgtgttgggaagcatatgga
gaactttgtagtttaggtgccgctgaagaagcctcaacagttttcgggaatgttgcttcc
cagcgtcttcagaaaacttgtgtagaacaaagaataagcttctcagaaggagcaaccata
gaccagattacagattctgataaggccttaaaagatacaggtttatcgcaaacagaacac
attccaggagagaaccaacaagatctgaaaattatgcagcagcctggagatattccacca
aatactgacaggcaacttagtacaaacggatgggacttgaacacaccttctccagtgctt
ttacaggtaatggatgctctaccgcctctgcttcttaagaatatgcgtcgtccagcagtg
gaaggatctttgatgtctgtacatggagtgcgtgtgcgtcgaagaaacttttttagtgaa
gaattgtcagcagaggctcaagaagaatctgggcgccgccgtagtgctagaatagcagca
aggaaaaagaatcctatgtcgcagtcatttggaaaagattcccattggttacatctttca
ccttccgagtcaaactatgcaccttctctttcctcgatgattggaaaatgcagaatccaa
agcagcaaagaagcaacgacgtcaggccagtctgtaagtgacattggaagctctgttgat
gatgaggaaaagtcaaatcctagtgaatcttccccggatcgtttcagccttatttctgga
atttcagaagtgctaagccttctgaaaattcttggagatggccacaggcatttacatatg
tacaagtgtcaggaagctttgttggcatatcaaaagctatctcagaaacaatacaataca
cactgggttctcatgcaggttggaaaagcatattttgagctacaagactacttcaacgct
gactcttcctttactcttgctcatcaaaagtatccttatgctttggaaggaatggataca
tactccactgttctttatcacctgaaagaagagatgaggttgggctatctggctcaggaa
ctgatttcagttgatcgcctgtctccagaatcctggtgtgcagttgggaactgttacagt
ttgcgtaaggatcatgatactgctctcaaaatgtttcagagagctatccaactgaatgaa
agattcacatatgcacataccctttgtggccacgagtttgccgcattggaagaattcgag
gatgcagagagatgctaccggaaggctctgggcatagatacgagacactataatgcatgg
tacggtcttggaatgacctatcttcgtcaggagaaattcgagtttgcgcagcatcaattt
caactggctctccaaataaatccaagatcttcagtcatcatgtgttactatggaattgct
ttgcatgagtcaaagagaaacgatgaggcgttgatgatgatggagaaggctgtactcact
gatgcaaagaatccgctccccaagtactacaaggctcacatattaaccagcctaggtgat
tatcacaaagcacagaaagttttagaagagctcaaagaatgtgctcctcaagaaagcagt
gtccatgcatcgcttggcaaaatatacaatcagctaaagcaatacgacaaagccgtgtta
catttcggcattgctttggatttaagcccttctccatctgatgctgtcaagataaaggct
tacatggagaggttgatactaccagacgagctggtgacggaggaaaatttgtag

DBGET integrated database retrieval system