KEGG   Arabidopsis thaliana (thale cress): AT3G16420Help
Entry
AT3G16420         CDS       T00041                                 

Gene name
PBP1
Definition
(RefSeq) PYK10-binding protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 298 aa AA seqDB search
MAQKVEAQGGKGANLWDDGSTHDAVTKIQLAAGIDGIQYVQFDYVKNGQPEQAPLRGTKG
RVLPADPFVINHPDEHLVSVEGWYSPEGIIQGIKFISNKKTSDVIGSDEGTHFTLQVKDK
KIIGFHGSAGGNLNSLGAYFAPLTTTTPLTPAKQLTAFGSDDGTVWDDGAYVGVKKVYVG
QAQDGISAVKFVYDKSPEEVTGEEHGKSTLLGFEEFVLDYPSEYITAVDGTYDKIFGSDG
SVITMLRFKTNKQTSPPFGLEAGTVFELKEEGHKIVGFHGRADVLLHKIGVHVRPLSN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaaaggtggaagcacaaggagggaaaggagccaacctatgggacgatggatcg
acacatgacgccgtgaccaagattcagctcgcagcaggcatagacggaattcaatatgtt
cagtttgattatgtcaagaacggacaacccgaacaagctcctcttcgtggtaccaaaggc
cgtgttctcccagctgatccgtttgtgattaaccatccagacgaacatctagtttctgta
gaaggttggtatagccctgaaggtatcattcaaggaattaagttcatctccaacaagaag
acttctgatgtcattggatccgatgagggtactcacttcactctacaagttaaagacaag
aagatcattggctttcatgggtctgccgggggcaatcttaattctcttggggcttacttt
gctccgttgactactacaactccgttgactcctgccaagcagctaacggcatttggtagt
gatgacggaactgtatgggatgatggtgcttacgttggggttaagaaggtgtacgttgga
caagcccaagatggaatctcagctgttaagtttgtgtacgacaaaagccctgaggaggtc
acaggagaagaacatggaaagagtactctactcggattcgaagagttcgtacttgactat
ccaagtgaatacatcaccgcagtcgatggcacttatgataaaatctttgggagtgatggc
tcagtcataactatgctcaggttcaagactaataagcaaacgtctcctccctttggactt
gaagctggcacagtcttcgaactcaaagaggaaggccacaagatcgttggtttccatgga
agagccgatgttctgctccacaaaattggagtccatgttcgtcctttatccaactga

DBGET integrated database retrieval system