KEGG   Arabidopsis thaliana (thale cress): AT3G16950Help
Entry
AT3G16950         CDS       T00041                                 

Gene name
LPD1
Definition
(RefSeq) lipoamide dehydrogenase 1
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Pyruvate oxidation, pyruvate => acetyl-CoA
Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT3G16950 (LPD1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G16950 (LPD1)
   00020 Citrate cycle (TCA cycle)
    AT3G16950 (LPD1)
   00620 Pyruvate metabolism
    AT3G16950 (LPD1)
   00630 Glyoxylate and dicarboxylate metabolism
    AT3G16950 (LPD1)
   00640 Propanoate metabolism
    AT3G16950 (LPD1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT3G16950 (LPD1)
   00280 Valine, leucine and isoleucine degradation
    AT3G16950 (LPD1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     AT3G16950 (LPD1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AT3G16950 (LPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 623 aa AA seqDB search
MQSAMALSFSQTSFTRPNHVLGSSGSVFSTPRSLRFCGLRREAFGFSTSNQLAIRSNRIQ
FLSRKSFQVSASASSNGNGAPPKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVV
GGTCVNRGCVPSKALLAVSGRMRELQNEHHMKSFGLQVSAAGYDRQGVADHANNLATKIR
NNLTNSMKAIGVDILTGFGSVLGPQKVKYGKDNIITAKDIIIATGSVPFVPKGIEVDGKT
VITSDHALKLESVPEWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEISKL
AQRVLINPRKIDYHTGVFASKITPARDGKPVLIELIDAKTKEPKDTLEVDAALIATGRAP
FTNGLGLENVNVVTQRGFIPVDERMRVIDGKGTLVPNLYCIGDANGKLMLAHAASAQGIS
VVEQVSGRDHVLNHLSIPAACFTHPEISMVGLTEPQAKEKGEKEGFKVSVVKTSFKANTK
ALAENEGEGIAKMIYRPDNGEILGVHIFGLHAADLIHEASNAIALGTRIQDIKLAVHAHP
TLSEVLDELFKAAKVESHATTRTGDAKIKLNTNQEDRKGRRRGGDDEKQPSVSKDLKDIS
TRPSSFFENISVGVLSLLSLIFV
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcagctatggcgctttcgttctcccagacgtcgtttacaagaccaaaccacgtg
ctcggatcatctggttctgttttctctacgcccagaagtctccggttctgcggactccgg
cgggaagcgtttggtttctcaacgtcgaatcagttggctattcgcagtaaccgaatccaa
tttctaagtaggaagtcattccaagtctccgcttctgcttcaagtaatggtaatggcgct
ccaccgaaatctttcgattacgatttgatcatcatcggagctggagttggtggccacgga
gctgctttgcacgccgttgaaaagggacttaaaacagccattattgaaggagatgttgtt
ggagggacttgtgttaacagaggatgtgtgccttctaaagctcttcttgctgttagtggt
cgaatgcgggaacttcagaacgaacatcacatgaagtcctttggtctccaggtttcagct
gctggatatgatcgtcagggtgtggcagatcatgctaataatctggctaccaaaatacga
aacaatctgaccaattcaatgaaggcaattggtgttgacatattgactggatttggcagt
gttctgggtccacaaaaggttaaatatgggaaggacaatattattactgcaaaagatata
atcattgccactggatctgtgccgtttgtccctaaaggaattgaagttgatggaaagact
gtgatcaccagtgaccatgctttgaaattagagtctgtccctgagtggattgcaattgta
ggaagtggttatattggtcttgagttcagtgatgtttacacagctcttggaagtgaggta
acttttatagaagcactggatcagctaatgcctggatttgatcctgagatcagtaagcta
gctcagagggttttgataaatccaagaaagattgactatcatactggagtctttgcaagc
aaaattactccggcaagggatgggaaaccagttctgattgagcttattgatgccaaaacc
aaggaacctaaggatactttggaggtagatgctgctcttattgctactgggagagctcca
ttcaccaatggacttggcttggaaaatgtcaatgttgtgacgcagagaggtttcatacca
gttgatgagcgaatgcgtgtgatcgatggaaaggggactctggttccgaacttgtactgc
attggtgatgccaatggtaaattgatgcttgcacatgcagccagtgcccaaggaatttct
gtggtcgagcaagtcagcggcagagatcatgtgcttaatcatcttagcatcccagctgct
tgctttactcatcctgaaatcagcatggtgggattaacagagcctcaagcaaaagaaaaa
ggcgagaaggaaggatttaaagttagtgttgtcaagacaagtttcaaggctaacacaaag
gccctagctgaaaatgaaggagaaggaatagctaagatgatataccgacctgacaatggt
gaaatcttaggagttcatatatttggactgcatgcagctgaccttatccatgaagcttct
aatgcgattgctctaggaacgcgtattcaggacataaaattggcagttcatgcacatcca
acactctctgaggtcctcgacgaactgttcaaagcagccaaggttgaaagtcatgctacg
acaaggacaggagatgcaaagataaagctaaacacgaaccaggaagatcgaaaaggaaga
agaagaggaggagatgatgagaaacaaccttccgtaagtaaagacttgaaagatatatct
acaaggccttcttctttctttgagaatatttctgttggagtcttgtctctgctttcactt
atatttgtttaa

DBGET integrated database retrieval system