KEGG   Arabidopsis thaliana (thale cress): AT3G17940Help
Entry
AT3G17940         CDS       T00041                                 

Definition
putative aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ath00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ath00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 341 aa AA seqDB search
MADQSKNTPEIFELNNGTMQVKISNYGTTITSLSVPDKNGKLGDVVLGFDSVDPYVKGLA
PYFGCIVGRVANRIKEGKFSLNGVNYTLPINKPPNSLHGGNKGFDKKIWEVAGHKRDGEK
PFITFKYHSADGEEGYPGAVSVTATYTLTSATTMRLDMEAVPENKDTPINLAQHTYWNLA
GHDSGNILDHKIQIWGSHITPVDEYTVPTGEILPVKGTPFDFTEEKRIGESIGEVGIGYD
HNYVLDCPDQEKEGLKHAAKLSDAASSRVLNLWTNVPGMQFYTGNYVNGVVGKGNAVYGK
HAGVCLETQGFPNAINQSNFPSVVVKAGEKYNHTMLFEFSA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcagagcaaaaacactccagagatcttcgagctcaacaatggcaccatgcag
gtcaagatctcaaactacggcaccaccatcacctctttgtctgttcccgacaagaacggg
aaactgggggatgtagttctcggattcgactcggtggatccatatgtgaaagggcttgca
ccatactttgggtgcattgttggtcgtgtggcaaatcggatcaaggagggaaaattcagt
ctcaatggagttaactacactttgcctatcaacaagcctcctaatagtctccacggtggt
aacaagggtttcgataagaagatatgggaagttgcagggcacaagagagacggcgaaaaa
cctttcatcactttcaaatatcacagtgccgatggagaagaaggttaccctggtgcggtt
tctgtcacggcgacatacactctcacgtcagccacgacaatgagacttgacatggaagct
gttccagagaacaaagatactcccatcaacttagctcaacatacatactggaacttagca
ggtcatgactcaggaaacattctagaccataagattcagatatgggggtctcatatcacg
ccggttgacgaatacacagttcctacaggagagatcttgcctgtaaagggaactcctttc
gatttcactgaggagaagcggataggcgagtctattggagaggttggtatcggatacgat
cataactacgtgttggactgtcctgatcaagagaaggaggggctgaaacacgcagcgaag
ctcagtgatgctgctagctcaagggtactgaacttgtggaccaatgtgccgggaatgcag
ttttataccgggaactatgtgaatggagtggttgggaaagggaatgcggtttacgggaaa
catgcgggtgtgtgccttgagacgcagggattcccgaacgcgattaaccagtcgaatttc
ccgtctgttgtggttaaggctggtgagaagtacaatcacacgatgctgtttgagttttca
gcttga

DBGET integrated database retrieval system