KEGG   Arabidopsis thaliana (thale cress): AT3G18070Help
Entry
AT3G18070         CDS       T00041                                 

Gene name
BGLU43
Definition
(RefSeq) beta glucosidase 43
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 501 aa AA seqDB search
MFLFLLLLSASRSGEESPSGDAVPLATGGLNRKSFPEGFLFGTATSAYQVEGETHQDGRG
PSIWDAFVKIPGKIANNATAEITVDQYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSG
KINSNGVAYYNRLIDYLIEKGITPYANLYHYDLPLALEQKYQGLLSKQGRFCGLRRVLFQ
TFGDRVKNWMTFNEPRVVAALGYDNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILAH
AAAVQRYRQNYQEKQKGRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGE
YPNTLQNIVKERLPKFTEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWN
VTFNFAKNGTPIGPRAHSEWLYNVPWGMYKALMYIEERYGNPTMILSENGMDDPGNITLT
QGLNDTTRVKYYRDYLVQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD
LKRYPKMSALWFKQLLKRDQK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttttctcctcctcctctctgcttcccgctccggcgaagagtcgccgtccgga
gacgccgtcccattggccaccggcggtcttaacagaaagagttttccggaaggattcttg
ttcggaaccgccacgtcagcttaccaggtcgaaggcgagacccaccaagatggtcgtggt
ccaagcatttgggatgcattcgtcaagattcctggtaagattgccaacaatgccactgct
gagataacagtggaccaatatcatcgttacaaggaagatgtagatttgatgcagaacctg
aacattgatgcctacagattttccatttcatggtctagaatattccctgagggatccggt
aaaatcaactcgaatggagttgcttattacaatagattgatcgattacttgatcgaaaaa
gggattacaccgtatgctaatctgtaccactatgaccttcctttagccttggaacaaaag
tatcaaggcctgcttagtaaacaaggaagattttgcggattacgcagagttttgtttcaa
acatttggagatagagtgaagaactggatgacgtttaacgagcctcgtgtagtagctgct
ctaggttatgataacggcatttttgcgccgggtagatgctctgaagcatttggaaactgc
actgatggaaactctgcaactgaaccatacattgttgcacatcaccttatcttggcacat
gcagcagccgtccagagataccgccaaaattatcaggagaaacaaaagggaagggttggg
attctactggattttgtttggtttgagccacttacgagtagtcaagcagacaatgacgct
gctcaaagagcaagagacttccatgttggatggtttattcacccaatagtgtatggagag
tacccaaatacgttgcaaaacatcgtgaaggagagacttccgaagttcaccgaggaagaa
gtgaaaatggtgaaaggttccatagacttcgtggggataaaccaatacacaacttatttc
atgtctgatcctaaaatatctaccacacctaaagatttgggttatcaacaagattggaac
gtcacttttaactttgcaaagaatgggacaccaattggtccaagggcacattcagaatgg
ttatacaatgtcccatggggaatgtacaaagctttaatgtacattgaggaacgttatggc
aacccaactatgattctctccgaaaacggtatggatgatccgggcaacataactctaact
caaggactaaatgatacaacaagagtcaagtattatagagactatttagtgcagcttaaa
aaagcagtagacgatggagccaatctaactggatattttgcgtggtcgttgctagataat
ttcgaatggttatcaggatatacttcaaggtttggaatagtgtacgttgattacaaggac
ttgaagagataccccaagatgtctgctttatggtttaaacaacttttgaaacgggaccag
aaatga

DBGET integrated database retrieval system