KEGG   Arabidopsis thaliana (thale cress): AT3G18070Help
Entry
AT3G18070         CDS       T00041                                 

Gene name
BGLU43
Definition
(RefSeq) beta glucosidase 43
  KO
K05350  
beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT3G18070 (BGLU43)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT3G18070 (BGLU43)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT3G18070 (BGLU43)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT3G18070 (BGLU43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
3
AA seq 501 aa AA seqDB search
MFLFLLLLSASRSGEESPSGDAVPLATGGLNRKSFPEGFLFGTATSAYQVEGETHQDGRG
PSIWDAFVKIPGKIANNATAEITVDQYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSG
KINSNGVAYYNRLIDYLIEKGITPYANLYHYDLPLALEQKYQGLLSKQGRFCGLRRVLFQ
TFGDRVKNWMTFNEPRVVAALGYDNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILAH
AAAVQRYRQNYQEKQKGRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGE
YPNTLQNIVKERLPKFTEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWN
VTFNFAKNGTPIGPRAHSEWLYNVPWGMYKALMYIEERYGNPTMILSENGMDDPGNITLT
QGLNDTTRVKYYRDYLVQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD
LKRYPKMSALWFKQLLKRDQK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttttctcctcctcctctctgcttcccgctccggcgaagagtcgccgtccgga
gacgccgtcccattggccaccggcggtcttaacagaaagagttttccggaaggattcttg
ttcggaaccgccacgtcagcttaccaggtcgaaggcgagacccaccaagatggtcgtggt
ccaagcatttgggatgcattcgtcaagattcctggtaagattgccaacaatgccactgct
gagataacagtggaccaatatcatcgttacaaggaagatgtagatttgatgcagaacctg
aacattgatgcctacagattttccatttcatggtctagaatattccctgagggatccggt
aaaatcaactcgaatggagttgcttattacaatagattgatcgattacttgatcgaaaaa
gggattacaccgtatgctaatctgtaccactatgaccttcctttagccttggaacaaaag
tatcaaggcctgcttagtaaacaaggaagattttgcggattacgcagagttttgtttcaa
acatttggagatagagtgaagaactggatgacgtttaacgagcctcgtgtagtagctgct
ctaggttatgataacggcatttttgcgccgggtagatgctctgaagcatttggaaactgc
actgatggaaactctgcaactgaaccatacattgttgcacatcaccttatcttggcacat
gcagcagccgtccagagataccgccaaaattatcaggagaaacaaaagggaagggttggg
attctactggattttgtttggtttgagccacttacgagtagtcaagcagacaatgacgct
gctcaaagagcaagagacttccatgttggatggtttattcacccaatagtgtatggagag
tacccaaatacgttgcaaaacatcgtgaaggagagacttccgaagttcaccgaggaagaa
gtgaaaatggtgaaaggttccatagacttcgtggggataaaccaatacacaacttatttc
atgtctgatcctaaaatatctaccacacctaaagatttgggttatcaacaagattggaac
gtcacttttaactttgcaaagaatgggacaccaattggtccaagggcacattcagaatgg
ttatacaatgtcccatggggaatgtacaaagctttaatgtacattgaggaacgttatggc
aacccaactatgattctctccgaaaacggtatggatgatccgggcaacataactctaact
caaggactaaatgatacaacaagagtcaagtattatagagactatttagtgcagcttaaa
aaagcagtagacgatggagccaatctaactggatattttgcgtggtcgttgctagataat
ttcgaatggttatcaggatatacttcaaggtttggaatagtgtacgttgattacaaggac
ttgaagagataccccaagatgtctgctttatggtttaaacaacttttgaaacgggaccag
aaatga

DBGET integrated database retrieval system