KEGG   Arabidopsis thaliana (thale cress): AT3G18430Help
Entry
AT3G18430         CDS       T00041                                 

Definition
(RefSeq) Calcium-binding EF-hand family protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AT3G18430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 EF-hand_9 DHC_N2
Motif
Other DBs
NCBI-GeneID: 821372
NCBI-ProteinID: NP_001189924
MIPS: AT3G18430.1
TAIR: AT3G18430
Araport: AT3G18430
UniProt: Q9LS47
Position
3
AA seq 175 aa AA seqDB search
MGNTSSMLTQYDIEEVQSHCHDLFEQQEILSLYQRFCQLDRNAKGFISADEFLSVPEFAM
NPLSQRLLKMVDGLNFKDFVAFLSAFSAKASLRQKVQLIFKVYDSDCNGKVSFKDIMEVL
RDLSGSFMSDEQREQVLSQVLKESGYTSDSFLTLEDFIKIFGSSRPEMDVEIPVD
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggaatacttcatcgatgctgactcagtacgacatcgaagaagttcagagtcattgt
catgatctatttgagcagcaggagattttatctctgtatcaacggttttgccagttagat
cgaaacgcaaaaggatttatatctgctgatgagtttctctctgtgcctgagtttgcgatg
aatccactctctcagaggctgcttaagatggttgatggtttgaactttaaggattttgtt
gctttcttgtctgcgtttagtgccaaggctagtctaagacagaaagttcaattgatcttt
aaagtctatgattcggactgcaacgggaaggtctcttttaaagatatcatggaagtgttg
cgtgacttatcgggatcattcatgtctgatgagcaaagagagcaagtactgagccaggtt
ttgaaggaatcgggctacacgagtgactcattcttaactctggaggatttcataaagatc
tttgggagtagtagaccggagatggacgttgaaattcctgtggattag

DBGET integrated database retrieval system