KEGG   Arabidopsis thaliana (thale cress): AT3G18520Help
Entry
AT3G18520         CDS       T00041                                 

Gene name
HDA15
Definition
histone deacetylase 15
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AT3G18520 (HDA15)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT3G18520 (HDA15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 552 aa AA seqDB search
MVVETIERSCEGSKRRHVNGGDIAVPCSGEECSNGDINVAPGVSAKRARVSREMTFEDIY
GADALLNDDDDEDDDCDWEPVQAPMEFVKWCCVNCTMSNPGDMVHCCICGEHKESGILRH
GYLASPFFKDTGLIEVEEKYGGSSSATSSTAVGFDERMLLHSEFEVKAQPHPERPDRLRA
IAASLATAGVFPGRCLPINAREITKQELQMVHTSEHVDAVDTTSQLLYSYFTSDTYANEY
SARAARLAAGLCADLATDIFTGRVKNGFALVRPPGHHAGVRHAMGFCLHNNAAVAALVAQ
AAGAKKVLIVDWDVHHGNGTQEIFEQNKSVLYISLHRHEGGNFYPGTGAADEVGSNGGEG
YCVNVPWSCGGVGDKDYIFAFQHVVLPIASAFSPDFVIISAGFDAARGDPLGCCDVTPAG
YSRMTQMLGDLCGGKMLVILEGGYNLRSISASATAVIKVLLGENPENELPIATTPSVAGL
QTVLDVLNIQLEFWPSLAISYSKLLSELEARLIENKKNQMKRKVVRVPTWWKWGRKKLLY
NFLSARMISRSK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagaaactatcgagaggtcttgtgagggttcaaagagaagacatgtgaacggt
ggagatatcgctgttccttgttcgggagaagagtgtagcaatggagatataaatgtagct
cctggagtttcagcgaaaagagctagggtttctagagaaatgacgtttgaagatatttac
ggtgctgatgcattactcaatgatgacgatgatgaggatgatgattgtgattgggaacct
gtgcaggcgcctatggagtttgtaaaatggtgttgtgtcaattgcactatgtcgaaccct
ggtgatatggtccactgttgtatatgcggtgagcacaaggaatctggcattttgaggcat
ggatatttagcgtctcccttttttaaagacactggtctcattgaagtcgaggagaaatat
ggaggaagctcatctgcaaccagctcgacagctgttgggttcgacgagagaatgttgcta
cactcagaatttgaagtgaaggcacaaccacatccagagagacctgatcgtcttcgagct
atagctgctagtcttgccacagctggtgtttttcctggaagatgcttgcctatcaatgca
agggaaatcacgaaacaagaactccagatggtccacacttcagagcatgttgatgctgtt
gatactacaagccagcttctctatagctacttcacctctgacacatatgctaatgagtat
tcagcacgtgctgctagacttgcagcaggtttgtgcgctgatctagctacagatattttc
actggccgtgtaaaaaatggttttgctttggttagacctcccggtcatcatgctggcgtc
aggcatgctatggggttttgccttcacaataatgcagccgttgctgcattagtagcacaa
gcagcaggggcaaagaaggtgctgattgtggactgggatgtccatcatggcaacggaacc
caagagatattcgaacaaaacaaatctgtattgtacatatccttgcacagacatgaggga
ggaaacttctatcccggtactggagctgctgatgaggttggttctaatggtggggaaggt
tattgtgtaaatgttccatggagttgcggtggagttggggataaagactatatctttgcg
tttcaacatgtggttctccccatagcttctgcattttctccagattttgtcatcatatct
gcgggatttgatgcggctagaggagacccactaggatgctgtgatgtgactccggctggc
tattctcgaatgacacagatgttgggtgatctgtgtggtgggaaaatgctagttattctc
gagggcggctacaatcttcgctccatatctgcttctgcaacagcagtgatcaaggtgctt
ctgggtgaaaatccggagaacgagttgcccatcgccaccacgccttcagtagccggcctg
caaactgttcttgatgtactgaatatccaactggagttctggccatcacttgctatcagc
tactccaaattactctcagagttggaagcacgtctgatcgaaaacaaaaaaaatcagatg
aaaaggaaggttgttcgggttccgacatggtggaaatggggacgaaagaagcttttgtac
aactttctctcggctcgtatgatttcaagatcaaagtga

DBGET integrated database retrieval system