KEGG   Arabidopsis thaliana (thale cress): AT3G18840Help
Entry
AT3G18840         CDS       T00041                                 

Definition
(RefSeq) LOW protein: PPR containing-like protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 PPR_1 PPR_3 PPR_long AEP1 DYW_deaminase Imm51
Motif
Other DBs
NCBI-GeneID: 821417
NCBI-ProteinID: NP_001078182
MIPS: AT3G18840.1
TAIR: AT3G18840
Araport: AT3G18840
UniProt: Q9LHN5 A0A178VAZ2
Position
3
AA seq 678 aa AA seqDB search
MKCLKDGFLHHIRSIKSGSTLTAVSSNQLVNLYSKSGLLREARNVFDEMLERNVYSWNAV
IAAYVKFNNVKEARELFESDNCERDLITYNTLLSGFAKTDGCESEAIEMFGEMHRKEKDD
IWIDDFTVTTMVKLSAKLTNVFYGEQLHGVLVKTGNDGTKFAVSSLIHMYSKCGKFKEVC
NIFNGSCVEFVDSVARNAMIAAYCREGDIDKALSVFWRNPELNDTISWNTLIAGYAQNGY
EEEALKMAVSMEENGLKWDEHSFGAVLNVLSSLKSLKIGKEVHARVLKNGSYSNKFVSSG
IVDVYCKCGNMKYAESAHLLYGFGNLYSASSMIVGYSSQGKMVEAKRLFDSLSEKNLVVW
TAMFLGYLNLRQPDSVLELARAFIANETNTPDSLVMVSVLGACSLQAYMEPGKEIHGHSL
RTGILMDKKLVTAFVDMYSKCGNVEYAERIFDSSFERDTVMYNAMIAGCAHHGHEAKSFQ
HFEDMTEGGFKPDEITFMALLSACRHRGLVLEGEKYFKSMIEAYNISPETGHYTCMIDLY
GKAYRLDKAIELMEGIDQVEKDAVILGAFLNACSWNKNTELVKEVEEKLLVIEGSNGSRY
IQIANAYASSGRWDEMQRIRHQMRGKELEIFSGCSWANIDKQFHMFTSSDISHYETEAIY
AMLHFVTKDLSEIDEIMI
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttaaaggatgggtttttgcatcacattcgctccattaaatctggttcaacc
ttaaccgcagtctcctcgaatcaacttgttaacctatactcaaaaagtggtttattgcga
gaagcacggaacgtgttcgacgaaatgcttgaaagaaacgtttactcatggaacgcagtg
atcgcagcctacgtaaagttcaacaacgtgaaggaagcgcgtgaattgttcgaaagtgat
aattgtgaacgagatttaattacgtacaacactctgctttcagggtttgccaaaactgat
gggtgtgagagtgaagctattgagatgtttggtgagatgcataggaaggagaaggatgat
atttggatagatgatttcactgtcactactatggttaaactttctgcaaagttaaccaat
gtgttttacggcgaacagttgcatggagttttggtgaaaacagggaatgatggaactaag
tttgccgttagttctctcattcacatgtattcgaaatgtgggaagtttaaggaagtctgt
aatatatttaacggatcgtgtgttgagtttgttgatagtgtggctaggaacgcaatgatt
gcagcttattgcagagaaggtgacattgataaagctttgagtgtattctggagaaatcca
gaactgaatgatacaatttcttggaatacattgattgcagggtatgcacagaatggttat
gaagaagaagctttgaagatggctgttagtatggaggaaaatgggttgaaatgggacgaa
cacagtttcggtgctgtactaaatgttctgagtagtttaaagagcctgaagattgggaag
gaagtacatgctagggtattgaagaatggatcatattctaataaatttgttagcagtgga
attgttgatgtttattgcaagtgtggaaatatgaagtatgcagagtctgctcatttgtta
tatggttttggaaacttgtattcagcttcttcaatgatcgtgggctactcgtctcagggg
aagatggtggaagcgaaaaggttatttgattctttatctgaaaagaatctagtggtctgg
actgcaatgtttttgggatatcttaatttacgtcaacctgattctgtgcttgagcttgct
cgtgcgtttatagccaatgagactaatactcctgattctttggtcatggtcagcgtcctt
ggtgcatgctctttacaagcttatatggaaccggggaaggagattcacggtcacagcttg
agaacaggcattttaatggataaaaaacttgttactgcatttgttgacatgtattcaaaa
tgtggaaatgttgagtatgctgaaaggatctttgacagtagcttcgagagagacacagtt
atgtacaacgcaatgatagctggttgtgctcatcatggtcatgaagccaaatctttccag
cactttgaagacatgactgagggtggattcaagccagatgaaatcacgtttatggccctc
ctatcagcttgtcgtcaccgcggcttagttctagaaggtgagaaatacttcaagtcgatg
atagaggcttacaacatatctcccgagactggtcactatacctgcatgatagatttgtat
ggaaaggcctataggttagacaaagccatagagcttatggaaggtattgatcaagttgaa
aaagatgccgttattcttggagcatttttaaatgcttgtagctggaataagaatacagag
cttgtgaaggaagtcgaagagaaattgttagtcattgaaggatctaacgggtctcgctat
attcaaatagctaacgcttatgcctcctctggtagatgggatgagatgcaacggatacgg
catcaaatgagagggaaggagctggaaattttttctgggtgcagctgggctaatatagat
aaacaatttcatatgtttacttcatctgacatttcccattatgaaacagaagctatatat
gcgatgctacattttgtgaccaaggatttgtctgaaatagatgaaatcatgatttaa

DBGET integrated database retrieval system