KEGG   Arabidopsis thaliana (thale cress): AT3G19940Help
Entry
AT3G19940         CDS       T00041                                 

Definition
(RefSeq) sugar transport protein 10
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 514 aa AA seqDB search
MAGGAFVSEGGGGGRSYEGGVTAFVIMTCIVAAMGGLLFGYDLGISGGVTSMEEFLTKFF
PQVESQMKKAKHDTAYCKFDNQMLQLFTSSLYLAALVASFMASVITRKHGRKVSMFIGGL
AFLIGALFNAFAVNVSMLIIGRLLLGVGVGFANQSTPVYLSEMAPAKIRGALNIGFQMAI
TIGILVANLINYGTSKMAQHGWRVSLGLAAVPAVVMVIGSFILPDTPNSMLERGKNEEAK
QMLKKIRGADNVDHEFQDLIDAVEAAKKVENPWKNIMESKYRPALIFCSAIPFFQQITGI
NVIMFYAPVLFKTLGFGDDAALMSAVITGVVNMLSTFVSIYAVDRYGRRLLFLEGGIQMF
ICQLLVGSFIGARFGTSGTGTLTPATADWILAFICVYVAGFAWSWGPLGWLVPSEICPLE
IRPAGQAINVSVNMFFTFLIGQFFLTMLCHMKFGLFYFFASMVAIMTVFIYFLLPETKGV
PIEEMGRVWKQHWFWKKYIPEDAIIGGHDDNNTN
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaggagcttttgtatcagaaggaggaggtggtggaagaagttatgaaggagga
gtcaccgcattcgttatcatgacatgtatcgtcgccgccatgggaggtctgctctttggt
tatgaccttggaatctcaggaggtgttacatcaatggaagagtttcttaccaagttcttc
cctcaagtagagagccagatgaaaaaggcgaagcacgacacggcttactgtaaatttgat
aaccaaatgctccaattgttcacttcttctctctacctcgcagctcttgtagcttccttt
atggcttcagttatcactaggaagcatggacgtaaagtctctatgtttattggtggactt
gctttcctcatcggtgcactttttaacgcatttgccgttaatgtttcaatgctcatcatc
ggtagactgttgcttggtgttggtgttggatttgctaatcagtctactccggtgtaccta
tctgaaatggctccagcgaagataagaggagctttaaacatcggttttcagatggctata
accattggaatcctagtggcgaatctgattaactatggaacatcaaagatggctcaacat
ggatggagggtttctttaggtttagcagctgttccagctgttgttatggtgattggatca
tttattttgcccgatacaccaaactcgatgctcgagagaggcaaaaatgaggaagcaaaa
caaatgttgaagaagatacgtggagctgacaatgttgatcatgagtttcaagatctcatt
gatgctgttgaagctgccaaaaaggtggaaaatccatggaagaacatcatggagagtaaa
tatagaccagctttaatcttctgctcggccattccctttttccaacagatcactggaatc
aatgtcattatgttctacgctcctgttctcttcaagactcttggttttggtgatgatgct
gctcttatgtctgctgttataaccggtgttgtcaacatgctttcaacctttgtctcaatt
tacgcggttgatagatatggtagaaggttgcttttcctcgaaggtggcattcaaatgttc
atttgtcagcttcttgttggttctttcatcggtgcaagattcggaacctcaggaaccgga
acattgacgccagcaacagcagactggattcttgctttcatatgtgtgtacgttgcagga
tttgcatggtcatggggtccattgggatggttggtaccgagtgagatatgtccattggaa
attagaccagcgggacaagccatcaacgtctcggtcaacatgttcttcacttttctcatt
ggtcaattctttttgacaatgctttgtcacatgaagtttggtctattctacttctttgca
agcatggttgcgatcatgacggttttcatttactttttgttgccggagaccaaaggtgtt
cctattgaagagatgggaagagtttggaagcaacattggttctggaaaaagtatatccca
gaagatgctattattggtggacatgatgacaacaataccaattaa

DBGET integrated database retrieval system