KEGG   Arabidopsis thaliana (thale cress): AT3G20010Help
Entry
AT3G20010         CDS       T00041                                 

Definition
(RefSeq) RING finger-related, SNF2 and helicase domain-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 1047 aa AA seqDB search
MDSAIEISSGSDSDDEVPPQPVWPQTRTRMDPTWLSRRPLPTVDSHARAEHTNQAPPNGA
SSDTSRPGVSKPFTGNGNTVNSRISSGSGADYVRLSSEQALKRTLPPSFNSPPLPARSGT
NNISNASGSRVGVDYERPLSQQALKRTLPPSFNPPPLPSRSGTNNIRNAGGSRFGADYSH
PAVSAVGNKSTFGDHYSGAHAEIGIQRGVNGVRILPPSLTHGTSASVLHHAGSSDPMHRF
GGGEDRNPDNDERLVYQAALQVLNQPMTESDLPPGTLSVPLMRHQKIALAWMFQKETSSF
NCPGGILADDQGLGKTVSTIALILKQKIVSQLKSESSCKQETEALVLDADDESDNAKHES
GSHVKPELKVSSNSETSVLSACGNDENDSSDMEKAEDEEANSSTRAFQWKRPAAGTLIVC
PASVVRQWARELDEKVSEESKLSVLVYHGSNRTKDPNELAEYDVVVTTYAIVTNEAPNKF
LVDEDENDEKNTDRYGLASGFSNNKKRKVVVGASKKSKRRGRKSTNDTSSEPDCGPLGKV
GWFRIVLDEAQTIKNYRTQMARSCCTLRAKRRWCLSGTPIQNTIDDLYSYFRFLRYDPYA
VYKSFYSTIKVPISRNSCQGYKKLQAVLRAIMLRRTKGTLLDGKPIINLPPKVVNLSQVD
FSVAERSFYKKLEADSRSQFKAYADAGTLSQNYANILLLLLRLRQACDHPQLVKRYNSDP
VGKVSEAAVRRLPREARSRLINRLESSSAICYECNEPPEKPVVTLCGHIFCYECVLEYIT
GDENTCPVPRCKQQLARDVVFSESSLRNCTSDDSGCSSSHDNGLDRSVFQKRDFCSSKIK
AVLDILQSLSQPDSPNSAQHGQMPSSSRPYDDDDVTIVEPMRLHSSSPSQGAVKTIIFSQ
WTGMLDLVELRILESGIEFRRLDGTMSLAARDRAVKEFSKKPDVKVMLMSLKAGNLGLNM
VAACHVILLDLWWNPTTEDQAIDRAHRIGQTRPVTVTRITIKDTVEDRILKLQEEKRTMV
ASAFGEEHGGSSATRLTVDDLKYLFMV
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggattctgctattgaaattagttcaggtagtgatagtgatgacgaagtaccaccgcag
cctgtttggccacaaactcgaaccaggatggatcccacatggctaagcaggagacctttg
cctacagtggatagccatgctagagctgaacatacaaatcaggctcctcccaatggtgcc
tcgagtgatacttctcggcctggagtctctaagcctttcacagggaatgggaacactgta
aactcgagaatttccagtggatctggtgctgattatgtgagactgtcttctgagcaagct
ctgaaaagaactcttccaccctcttttaattcccctccccttcctgccagaagtggcact
aacaatataagtaatgctagtggaagtcgtgttggtgtggattatgagagaccattgtct
cagcaagctctgaaaagaactcttccaccctcttttaatccccctccccttccttccaga
agtggcacaaacaatatacgtaatgctggtgggagtcgctttggtgccgattatagtcat
ccagctgtgtcagctgtaggcaacaagagtacctttggtgatcattatagtggagcccat
gctgagataggaattcaacgtggcgtgaatggggttaggatcctgcctccatctctgacg
catggaacatctgcttctgttttgcatcatgctggttcgagtgatccaatgcacaggttt
ggtggtggtgaagataggaatcctgataacgatgaaaggctggtttatcaggctgcacta
caggttttgaatcaacccatgactgaaagtgatctacctcctggtactctttcagttcct
cttatgaggcatcagaaaattgcgttggcatggatgtttcagaaggaaacaagtagtttc
aactgtccaggagggatactagcagatgatcagggacttggtaagacggtctcgacgatt
gctcttatcctaaagcaaaagattgtgtcacaactgaagtccgaaagttcatgcaagcaa
gaaactgaggcattagtcctggatgctgatgatgagtcagacaatgcaaagcatgaaagt
ggtagtcatgtaaaaccagagctcaaggtttcaagcaacagtgagacctcggttctgagt
gcatgtggtaatgatgagaatgacagttcagatatggagaaagccgaagatgaagaagct
aattcttcaacacgagcatttcagtggaagagaccagctgctggtacattaattgtttgc
ccagcgagtgttgtaaggcagtgggcaagagagcttgatgagaaggtttctgaagaatcc
aaactttctgtgttagtctaccatggtagtaataggaccaaagatcctaatgaattagca
gaatacgatgtggttgtgacaacgtacgctattgttactaatgaagctcccaacaaattc
ttggtggatgaggatgagaacgatgaaaaaaatactgacagatatggtcttgcctctggc
ttctccaacaataagaaacggaaagtcgtggtgggtgctagtaagaagagtaaaagaaga
ggtagaaaaagcactaacgatacttcttctgagcctgattgtggtcctctaggaaaggtt
gggtggttcagaatagtactagatgaagctcagacaattaagaactatagaacacaaatg
gcaagatcatgttgcactcttcgagccaaaaggaggtggtgcttgtctggaacaccaata
caaaatacgattgatgatttatatagctatttcaggtttcttagatatgatccatatgcg
gtgtacaagtcattttacagtacaatcaaggttccaatttccagaaattcttgtcaaggt
tacaagaagcttcaagctgttctaagggctataatgctgcgccgcaccaaaggaacattg
cttgatgggaaacccataattaatctacctccaaaggtagtaaatttgagccaggtagac
ttttcagtggctgagcgctctttctacaagaagcttgaagctgattcacgttcacagttc
aaggcctatgctgatgcgggaactttgagtcaaaactacgcaaatattcttctgttgctt
ttgcgactacgccaagcttgtgaccacccacaacttgttaaaagatataactcagatcct
gttggaaaagtatcagaagcagcagttagaagactccctagggaggctcgaagcagactg
atcaatcgcttagagtcatcatctgccatctgctatgagtgcaatgagccaccagaaaaa
cctgttgttacgttgtgtggccatatattttgctatgaatgtgttttagaatacataact
ggggatgagaacacgtgccctgtaccgagatgcaaacaacagcttgcgcgtgatgttgtt
ttctctgaatcttctcttagaaattgcacttctgatgattcgggctgtagttcctctcat
gataatggtcttgatagatcggtatttcaaaaaagagacttttgttcatcaaaaattaaa
gctgtcctcgatatcctgcagtcgctttcccaaccagacagtccaaactcagctcagcat
ggtcaaatgccatcttcctcacggccatatgatgacgatgatgttaccattgtagagcca
atgcgtcttcactcatcttcacctagccagggggcagtaaagacgataatattttctcag
tggactggtatgcttgacttggttgagctgcgtattcttgaaagtggtattgaattcaga
agattagatggcacaatgagtctagcagcaagagacagggcggttaaagaattcagtaaa
aaaccagatgtaaaggtgatgctgatgtcgctaaaagctggaaaccttgggctgaatatg
gtagctgcatgtcatgttattctcttggatctttggtggaatccaactaccgaagatcag
gcgattgatcgtgcacatcgtattggacaaactcggccagttactgtaactcgcataact
ataaaagacaccgttgaggatagaattttgaagcttcaggaagagaaaaggacaatggtt
gcatcggcctttggtgaagaacatggtggaagctctgcgacacgtctaacagtagacgat
ctcaagtatctgtttatggtgtag

DBGET integrated database retrieval system