KEGG   Arabidopsis thaliana (thale cress): AT3G20630Help
Entry
AT3G20630         CDS       T00041                                 

Gene name
UBP14
Definition
ubiquitin carboxyl-terminal hydrolase 14
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT3G20630 (UBP14)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT3G20630 (UBP14)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT3G20630 (UBP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 797 aa AA seqDB search
MELLRSNLSRVQIPEPTHRIYKHECCISFDTPRSEGGLFVDMNSFLAFGKDYVSWNYEKT
GNPVYLHIKQTRKSIPEDRPLKKPTLLAIGVDGGFDNNEPEYEESYSIVILPDFVSLPFP
SVELPEKVRIAVDTVVNAVGAERKEQVAAWTAEKKLISEHALTLQQIKSGIVIPPSGWKC
SKCDKTENLWLNLTDGMILCGRKNWDGTGGNNHAVEHYKETAYPLAVKLGTITADLEAAD
VYSYPEDDSVLDPLLAEHLAHFGIDFSSMQKTEMTTAERELDQNTNFDWNRIQESGKELV
PVFGPGYTGLVNLGNSCYLAATMQIVFSTHSFISRYFSHQSLKMAFEMAPADPTLDLNMQ
LTKLGHGLLSGKYSMPATQKDATTGDPRQEGIPPRMFKNVIAASHAEFSSMRQQDALDFF
LHLVGKVERASNTTPDLDPSRSFKFGIEEKILCPSGKVGYNKREDCILSLNIPLHEATNK
DELEAFHKQKAGKGLEENDMRSSDEIVRPRVPLEACLANFASSEPIEDYYSSALKGMTTA
IKTTGLTSFPDYLVLHMRKFVMEEGWVPKKLDVYIDVPDVIDISHMRSKGLQPGEELLPD
GVPEEVMESAQPVANEEIVAQLVSMGFSQLHCQKAAINTSNAGVEEAMNWLLSHMDDPDI
DAPISHQTSDIDQSSVDTLLSFGFAEDVARKALKASGGDIEKATDWVFNNPNASVSDMDV
SSSNSAQTPAQSGLPDGGGKYKLFGIVSHMGTSVHCGHYVAHILKEGRWVIFNDDKVGIS
TDPPKDMGYVYFFQRLD
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctccgatccaacttgtctagggttcagatccctgaacctactcatcgcatc
tacaagcatgagtgttgcatctccttcgatactccgagatccgaaggaggattgttcgtt
gatatgaatagttttcttgctttcgggaaggattatgtttcttggaactatgagaagact
ggaaaccctgtttatcttcatattaagcagactaggaagtctattcccgaggatcggcct
ctcaagaaaccgactctgctcgctataggtgttgatggaggctttgataacaatgagcca
gagtacgaggagtcttatagcatagtcatacttccggattttgtttcactcccgtttcct
tctgttgagctaccagagaaggtgaggattgctgtcgatactgtagtgaatgccgttggt
gctgagcggaaagagcaagttgcagcttggacagctgagaaaaagttaattagtgaacat
gcattgacactgcagcaaatcaagagtggcattgtcattcctccctctggttggaaatgt
tctaagtgtgataagacggagaatctctggcttaatcttaccgatggaatgattctctgt
ggaagaaaaaactgggatggaactggtggaaacaaccatgctgttgagcactacaaagag
acagcctaccctcttgctgtaaagcttggaactatcactgctgacttagaagcagcagat
gtttattcctatccggaagatgacagtgttttggacccgctcctggctgagcatctggcc
cattttggaattgacttctcgtcgatgcagaagactgaaatgacaactgctgaaagagaa
cttgatcaaaatacaaattttgattggaaccgtatacaagagagtggaaaagaattggtg
ccagtttttggacctggatataccggacttgtcaatcttgggaacagttgctacttggca
gctacgatgcagattgttttctctacccattcatttatttcaagatacttttcacatcag
agcttaaagatggcttttgagatggctcctgctgatccaactttggacctcaatatgcaa
ttaacaaagcttggacacggcttactatctgggaagtactcaatgcctgcaactcagaag
gatgctacaactggagatcctagacaagaaggaatacctcctcgcatgttcaaaaacgta
attgccgcgagccacgcagaattctcttctatgagacagcaggatgctctcgactttttc
ctccatctggtaggcaaggttgagcgtgctagcaacacgacaccagatttagacccctcg
aggagcttcaagtttggaatagaagagaagatcctttgtccgtctggaaaggttggatat
aataagagggaagactgtattctttctttgaacattccgctacatgaggcaactaataaa
gatgaattagaagcctttcacaagcaaaaagcaggaaaaggattggaagagaatgatatg
aggtcaagtgatgaaatagtacgcccacgagttcctttagaagcctgtctagcaaatttt
gcatcatcagagccgattgaagactactatagctctgctttgaagggaatgacaacagct
atcaagacaactggtttgacatctttcccagattatttggtcttgcacatgcggaaattt
gttatggaggaaggctgggtgccaaagaaacttgatgtatacattgatgttccggatgtt
attgatatcagccacatgcgtagcaaaggactccaacctggggaagaactgttgccagat
ggcgttccagaagaagtgatggaatcagcgcagcccgtggcaaatgaggagatagttgca
cagctagtctcaatgggatttagccagcttcactgccagaaagctgccataaatacttcc
aatgctggggttgaagaggcaatgaactggttactttctcacatggatgatccagacatc
gatgcaccaatctcccaccagacatctgacattgatcaatcaagcgttgataccttactc
tcctttggttttgctgaagatgttgctcggaaggcactaaaagcctcgggaggagacatt
gagaaagcaacagactgggtattcaacaaccctaatgcatctgtttcagacatggatgta
tcctctagcaattcagcgcagactccggctcaaagtggattaccagatggaggagggaaa
tacaagctgtttggaatagtaagtcacatgggaacatcagtgcactgtggtcattacgtg
gctcacatattgaaagaaggccgctgggtaattttcaatgacgacaaagttggtatctcg
actgatcctcctaaagacatgggttatgtctacttctttcagcggcttgattga

DBGET integrated database retrieval system