KEGG   Arabidopsis thaliana (thale cress): AT3G20770Help
Entry
AT3G20770         CDS       T00041                                 

Gene name
EIN3
Definition
(RefSeq) Ethylene insensitive 3 family protein
  KO
K14514  
ethylene-insensitive protein 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
MAPK signaling pathway - plant
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    AT3G20770 (EIN3)
   04075 Plant hormone signal transduction
    AT3G20770 (EIN3)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Other transcription factors
   Others
    AT3G20770 (EIN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 628 aa AA seqDB search
MMFNEMGMCGNMDFFSSGSLGEVDFCPVPQAEPDSIVEDDYTDDEIDVDELERRMWRDKM
RLKRLKEQDKGKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGII
PENGKPVTGASDNLREWWKDKVRFDRNGPAAITKYQAENNIPGIHEGNNPIGPTPHTLQE
LQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGKEDWWPQLGLPKDQGPAPYKKP
HDLKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEESLAR
ELYPESCPPLSLSGGSCSLLMNDCSQYDVEGFEKESHYEVEELKPEKVMNSSNFGMVAKM
HDFPVKEEVPAGNSEFMRKRKPNRDLNTIMDRTVFTCENLGCAHSEISRGFLDRNSRDNH
QLACPHRDSRLPYGAAPSRFHVNEVKPVVGFPQPRPVNSVAQPIDLTGIVPEDGQKMISE
LMSMYDRNVQSNQTSMVMENQSVSLLQPTVHNHQEHLQFPGNMVEGSFFEDLNIPNRANN
NNSSNNQTFFQGNNNNNNVFKFDTADHNNFEAAHNNNNNSSGNRFQLVFDSTPFDMASFD
YRDDMSMPGVVGTMDGMQQKQQDVSIWF
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttaatgagatgggaatgtgtggaaacatggatttcttctcttctggatcactt
ggtgaagttgatttctgtcctgttccacaagctgagcctgattccattgttgaagatgac
tatactgatgatgagattgatgttgatgaattggagaggaggatgtggagagacaaaatg
cggcttaaacgtctcaaggagcaggataagggtaaagaaggtgttgatgctgctaaacag
aggcagtctcaagagcaagctaggaggaagaaaatgtctagagctcaagatgggatcttg
aagtatatgttgaagatgatggaagtttgtaaagctcaaggctttgtttatgggattatt
ccggagaatgggaagcctgtgactggtgcttctgataatttaagggagtggtggaaagat
aaggttaggtttgatcgtaatggtcctgcggctattaccaagtatcaagcggagaataat
atcccggggattcatgaaggtaataacccgattggaccgactcctcataccttgcaagag
cttcaagacacgactcttggatcgcttttgtctgcgttgatgcaacactgtgatcctcct
cagagacgttttcctttggagaaaggagttcctcctccgtggtggcctaatgggaaagag
gattggtggcctcaacttggtttgcctaaagatcaaggtcctgcaccttacaagaagcct
catgatttgaagaaggcgtggaaagtcggcgttttgactgcggttatcaagcatatgttt
cctgatattgctaagatccgtaagctcgtgaggcaatctaaatgtttgcaggataagatg
actgctaaagagagtgctacctggcttgctattattaaccaagaagagtccttggctaga
gagctttatcccgagtcatgtccacctctttctctgtctggtggaagttgctcgcttctg
atgaatgattgcagtcaatacgatgttgaaggtttcgagaaggagtctcactatgaagtg
gaagagctcaagccagaaaaagttatgaattcttcaaactttgggatggttgctaaaatg
catgactttcctgtcaaagaagaagtcccagcaggaaactcggaattcatgagaaagaga
aagccaaacagagatctgaacactattatggacagaaccgttttcacctgcgagaatctt
gggtgtgcgcacagcgaaatcagccggggatttctggataggaattcgagagacaaccat
caactggcatgtccacatcgagacagtcgcttaccgtatggagcagcaccatccaggttt
catgtcaatgaagttaagcctgtagttggatttcctcagccaaggccagtgaactcagta
gcccaaccaattgacttaacgggtatagttcctgaagatggacagaagatgatctcagag
ctcatgtccatgtacgacagaaatgtccagagcaaccaaacctctatggtcatggaaaat
caaagcgtgtcactgcttcaacccacagtccataaccatcaagaacatctccagttccca
ggaaacatggtggaaggaagtttctttgaagacttgaacatcccaaacagagcaaacaac
aacaacagcagcaacaatcaaacgttttttcaagggaacaacaacaacaacaatgtgttt
aagttcgacactgcagatcacaacaactttgaagctgcacataacaacaacaataacagt
agcggcaacaggttccagcttgtgtttgattccacaccgttcgacatggcgtcattcgat
tacagagatgatatgtcgatgccaggagtagtaggaacgatggatggaatgcagcagaag
cagcaagatgtatccatatggttctaa

DBGET integrated database retrieval system