KEGG   Arabidopsis thaliana (thale cress): AT3G21280Help
Entry
AT3G21280         CDS       T00041                                 

Gene name
UBP7
Definition
ubiquitin-specific protease 7
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 532 aa AA seqDB search
MVIKPDPNQPGSTHPVRILAYIETKKEEEGKFFFFDIACLGFKKEINLVSLQHQTMLTVS
VKWQKKVFESIEIDTSQPPFVFKAQLYDLSGVPPERQKIMVKGGLLKDDADWSTLGLKNG
QKLMMMGTADEIVKAPEKGPVFMEDLPEEQQAANLGYSAGLVNLGNTCYMNSTMQCLISV
PELKSELSNYQSARTKDVDQTSHMLTVATRELFSELDKSVKAVAPMPFWMVLQKKYPQFA
QLHNGNHMQQDAEECWTQMLYTLSQSLKLPSPSEDPDAVKALFGLNLLNRLHCQESSEES
SETESVFSLKCHISHEVNHLHEGLKHGLKGELEKTSPSLGRTAVYVKESLIDSLPRYLTV
QFVRFFWKRESNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDIEGQKLGLQA
SAKSSSKGDDVKMTDAEGSSNQSGESSTGDQQEGASPHMTGIYDLVSVLTHKGRSADSGH
YVAWVKQESGKWVQYDDANTSLQRGEDIIKLSGGGDWHMAYIVMYKARLISM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcaaacccgacccgaatcaacccggatcgacccacccggttcggatactggca
tatatagagacgaagaaagaagaagaaggcaagttttttttttttgatatagcttgcctt
ggcttcaagaaagaaatcaatctcgtttctcttcagcatcaaacaatgttaacagtgagc
gtgaagtggcaaaagaaggtgtttgagagtatcgagattgatactagccagcctcctttt
gttttcaaggctcagttgtatgatttgagtggagttccgcctgagcggcaaaagatcatg
gtcaaaggtggccttttgaaggatgatgcagattggtctacgttgggactgaaaaatggt
caaaaattgatgatgatgggaactgcagatgaaatagtgaaggctccagagaagggtcct
gtttttatggaggatcttcctgaagaacagcaggctgctaatctgggctacagtgctggc
ctagtcaatcttggaaacacctgttacatgaactcaacgatgcagtgtttaatatctgtc
ccagagttgaaatctgaattatccaattaccaatctgctcgaaccaaggatgtggatcag
acttctcacatgctcactgttgcaacacgtgagttatttagtgagcttgataaaagtgtc
aaggctgttgcgcctatgccgttctggatggtgttacaaaaaaaatatcctcagtttgct
cagttgcataacggaaatcacatgcaacaggatgctgaagaatgttggacacaaatgttg
tacactctttcccagtccctaaaactgccatcgcctagtgaagatcctgatgctgtgaag
gctctttttggtctcaaccttctaaacaggttgcattgccaagaaagtagcgaagaaagc
tcagagacagaatctgtcttttctctgaaatgtcacatatcacatgaggtgaaccacttg
catgaaggattaaaacatggactgaaaggagaacttgaaaaaacatctccttctctgggt
cgtacagcggtttacgtaaaggagtctcttatagattcattgccaaggtacttgactgtt
cagtttgtgagattcttctggaaacgggagagtaatcagaaagcaaaaattctccggaaa
gtggattatccgttggagttggatatatatgacctttgttctgaggatcttcgaaagaaa
ctggaagctcctcgacagaaactgagagatattgaaggtcaaaagcttggtctgcaagcc
agtgcaaagagcagctcaaagggtgatgatgtgaaaatgactgatgctgagggatcatca
aaccaaagtggcgaatcatcaactggtgaccaacaggaaggtgcttcgcctcacatgacc
ggaatttatgacctggtatcggtgttgacccacaaaggcagaagcgcagactctgggcat
tatgttgcatgggtcaagcaagagagtggtaagtgggttcaatacgacgatgccaacact
agtcttcaacggggagaagatatcattaaactctctggaggaggtgattggcatatggca
tacatcgtaatgtacaaggcccgtctcatctccatgtaa

DBGET integrated database retrieval system