KEGG   Arabidopsis thaliana (thale cress): AT3G21370Help
Entry
AT3G21370         CDS       T00041                                 

Gene name
BGLU19
Definition
(RefSeq) beta glucosidase 19
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00460  Cyanoamino acid metabolism
ath00500  Starch and sucrose metabolism
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT3G21370 (BGLU19)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT3G21370 (BGLU19)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT3G21370 (BGLU19)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT3G21370 (BGLU19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 DUF1256
Motif
Other DBs
NCBI-GeneID: 821691
NCBI-ProteinID: NP_188774
MIPS: AT3G21370.1
TAIR: AT3G21370
Araport: AT3G21370
UniProt: Q9LIF9
Position
3
AA seq 527 aa AA seqDB search
MKIPLLGLLLLISLVGSPTRAEEGPVCPKTETLSRASFPEGFMFGTATAAFQVEGAVNEG
CRGPSLWDIYTKKFPHRVKNHNADEAVDFYHRYKEDIQLMKKLNTDGFRLSISWPRIFPH
GRMEKGISKEGVQFYHDLIDELLKNDITPLVTVFHWDTPADLEDEYGGFLSERIVPDFVE
YANFTFHEYGDKVKNWITFNEPWVFSRSGYDVGKKAPGRCSPYVKEFGKLCQDGRSGFEP
YVVSHNLLVGHAEAVDAFRKCEKCKGGKIGIAHSPAWFEPEDVEGGQATVNRVLDFVIGW
HLDPTTFGDYPQSMKDAVGSRLPRFTKAQKAKLKDSTDFVGINYYTSFFAKADQKVDSRN
PTWATDALVEFEPKTVDGSIKIGSQPNTAKMAVYAKGLRKLMKYIKDRYNSPEIIITENG
YGEDLGDKDTDLSVALNDHNRKYYLQRHLLALNEAICEDKVNVTSYFLWSLMDNFEWQDG
YTARFGVYYIDFKNNLTRMEKESAKWLSEFLKPGLKPSKSSKLHEEL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcctctcttggggttacttttactaataagtcttgtcggctctccgacaagg
gctgaagaaggacctgtttgcccgaagaccgaaactcttagccgtgcaagttttccggag
ggctttatgtttggtaccgcaaccgcagcctttcaggtggaaggtgcagtaaatgaaggt
tgcagaggtccaagcctgtgggacatctacaccaagaaatttccacatagagttaagaat
cacaatgctgacgaggccgtcgatttctaccatcgctacaaggaggatatccagttgatg
aaaaagctgaacactgatggttttagactttctatttcgtggccaagaatatttcctcat
gggaggatggagaaaggaataagcaaagaaggagttcaattttaccacgatcttattgat
gagctccttaaaaatgacataacaccattagtaacggtttttcattgggatactcccgcc
gatttggaagatgaatacggtggctttttaagcgaacgtattgtgcctgattttgtggag
tatgcaaacttcacgttccacgagtatggggacaaagtgaaaaactggattacgttcaac
gagccatgggtctttagccgttcgggctacgacgttgggaagaaagcaccaggacgttgt
tctccttacgtcaaagagtttggaaagctttgtcaagatggacggtcaggattcgaacct
tatgttgtcagtcacaatttactcgtgggtcatgctgaagctgttgatgctttccgaaaa
tgcgaaaagtgcaaaggtggtaaaatcggaatcgctcatagtccagcttggtttgaaccc
gaagatgtggaaggaggtcaagcgactgtaaaccgtgtgcttgatttcgtcattggctgg
catttggatcctaccacgttcggggactatcctcagtctatgaaagacgcggttggatct
cggttgccaagatttaccaaagcccaaaaggcaaaactgaaagattcgacagacttcgtg
ggaataaactattacacttccttctttgcaaaggctgaccagaaggttgatagtcggaac
ccgacttgggctacagatgctctagtcgaatttgaaccgaagactgtggatggatccatt
aaaattggtagccagcccaacactgctaagatggctgtctacgctaagggtttgaggaag
ctcatgaaatacattaaggacagatacaacagccctgagatcataatcactgagaatggc
tacggggaggaccttggcgataaagatacagatcttagcgttgctctcaacgaccacaac
aggaaatactatctccagaggcatcttttggcactgaatgaagctatatgtgaagacaag
gtgaatgttacatcgtatttcttgtggtctttaatggacaacttcgagtggcaagacggg
tacacagctaggttcggagtttactacatagacttcaagaacaacttgactcgtatggag
aaagaatccgcaaaatggctttctgaattcctcaaaccaggcctgaaaccatctaagtcc
tcaaagctacacgaggagctctga

DBGET integrated database retrieval system