KEGG   Arabidopsis thaliana (thale cress): AT3G21720Help
Entry
AT3G21720         CDS       T00041                                 

Gene name
ICL
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT3G21720 (ICL)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT3G21720 (ICL)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AT3G21720 (ICL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 576 aa AA seqDB search
MAASFSVPSMIMEEEGRFEAEVAEVQTWWSSERFKLTRRPYTARDVVALRGHLKQGYASN
EMAKKLWRTLKSHQANGTASRTFGALDPVQVTMMAKHLDTIYVSGWQCSSTHTSTNEPGP
DLADYPYDTVPNKVEHLFFAQQYHDRKQREARMSMSREERTKTPFVDYLKPIIADGDTGF
GGTTATVKLCKLFVERGAAGVHIEDQSSVTKKCGHMAGKVLVAVSEHINRLVAARLQFDV
MGTETVLVARTDAVAATLIQSNIDARDHQFILGATNPSLRGKSLSSLLAEGMTVGKNGPA
LQSIEDQWLGSAGLMTFSEAVVQAIKRMNLNENEKNQRLSEWLTHARYENCLSNEQGRVL
AAKLGVTDLFWDWDLPRTREGFYRFQGSVAAAVVRGWAFAQIADIIWMETASPDLNECTQ
FAEGIKSKTPEVMLAYNLSPSFNWDASGMTDQQMVEFIPRIARLGYCWQFITLAGFHADA
LVVDTFAKDYARRGMLAYVERIQREERTHGVDTLAHQKWSGANYYDRYLKTVQGGISSTA
AMGKGVTEEQFKESWTRPGADGMGEGTSLVVAKSRM
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatctttctctgtcccctctatgataatggaagaagaagggagattcgaagcg
gaggttgcggaagtgcagacttggtggagctcagagaggttcaagctaacaaggcgccct
tacactgcccgtgacgtggtggctctacgtggccatctcaagcaaggctatgcttcgaac
gagatggctaagaagctgtggagaacgctcaaaagccatcaagccaacggtacggcctct
cgcaccttcggagcgttggaccctgttcaggtgaccatgatggctaaacatttggacacc
atctatgtctctggttggcagtgctcgtccactcacacatccactaatgagcctggtcct
gatcttgctgattatccgtacgacaccgttcctaacaaggttgaacacctcttcttcgct
cagcagtaccatgacagaaagcagagggaggcaagaatgagcatgagcagagaagagagg
acaaaaactccgttcgtggactacctaaagcccatcatcgccgacggagacaccggcttt
ggcggcaccaccgccaccgtcaaactctgcaagcttttcgttgaaagaggcgccgctggg
gtccacatcgaggaccagtcctccgtcaccaagaagtgtggccacatggccggaaaggtc
ctcgtggcagtcagcgaacacatcaaccgccttgtcgcggctcggctccagttcgacgtg
atgggtacagagaccgtccttgttgctagaacagatgcggtcgcagctactctgatccag
tcgaacattgacgcgagggaccaccagttcatcctcggtgccactaacccgagccttaga
ggcaagagtttgtcctcgcttctggctgagggaatgactgtaggcaagaatggtccggcg
ttgcaatccattgaagatcagtggcttggctcggccggtcttatgactttctcggaagct
gtcgtgcaggccatcaagcgcatgaacctcaacgagaacgagaagaatcagagactgagc
gagtggttaacccatgcaaggtatgagaactgcctgtcaaatgagcaaggccgagtgtta
gcagcaaaacttggtgtgacagatcttttctgggactgggacttgccgagaaccagagaa
ggattctaccggttccaaggctcggtcgcagcggccgtggtccgtggctgggcctttgca
cagatcgcagacatcatctggatggaaacggcaagccctgatctcaatgaatgcacccaa
ttcgccgaaggtatcaagtccaagacaccggaggtcatgctcgcctacaatctctcgccg
tccttcaactgggacgcttccggtatgacggatcagcagatggttgagttcattccgcgg
attgctaggctcggatattgttggcagttcataacgcttgcgggtttccatgcggatgct
cttgtggttgatacatttgcaaaggattacgctaggcgcgggatgttggcttatgtggag
aggatacaaagagaagagaggacccatggggttgacactttggctcaccagaaatggtcc
ggtgctaattactatgatcgttatcttaagaccgtccaaggtggaatctcctccactgca
gccatgggaaaaggtgtcactgaagaacagttcaaggagagttggacaaggccgggagct
gatggaatgggtgaagggactagccttgtggtcgccaagtcaagaatgtaa

DBGET integrated database retrieval system