KEGG   Arabidopsis thaliana (thale cress): AT3G21860Help
Entry
AT3G21860         CDS       T00041                                 

Gene name
SK10
Definition
(RefSeq) SKP1-like protein 10
  KO
K03094  
S-phase kinase-associated protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT3G21860 (SK10)
   04120 Ubiquitin mediated proteolysis
    AT3G21860 (SK10)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     AT3G21860 (SK10)
   Cul7 complex
     AT3G21860 (SK10)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     AT3G21860 (SK10)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     AT3G21860 (SK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 152 aa AA seqDB search
MSTKKIILKSSDGHSFEVEEEAACQCQTIAHMSEDDCTDNGIPLPEVTGKILEMVIEYCN
KHHVDAANPCSDEDLKKWDKEFMEKYQSTIFDLIMAANYLNIKSLLDLACQTVADMIKDN
TVEHTRKFFNIENDYTHEEEEAVRRENQWGFE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgaagaagatcatattgaagagctccgatggtcactcattcgaggtcgaagaa
gaggccgcatgccaatgccagaccatagctcatatgagtgaagacgattgtaccgataat
ggaatcccgcttccagaagtgacaggcaagattcttgagatggtgatcgagtactgcaac
aagcaccacgtcgatgccgctaatccttgctccgacgaggatctcaagaagtgggacaag
gaattcatggaaaaatatcaatccacgatctttgatctcattatggctgcgaattaccta
aacatcaaaagccttcttgatctagcatgccaaaccgtcgcggatatgatcaaagacaac
actgtggagcacactcgcaaattcttcaacattgagaatgattatacacatgaggaagaa
gaagcggttcgtagggagaatcaatggggttttgaatga

DBGET integrated database retrieval system