KEGG   Arabidopsis thaliana (thale cress): AT3G22800Help
Entry
AT3G22800         CDS       T00041                                 

Definition
(RefSeq) Leucine-rich repeat (LRR) family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRRNT_2
Motif
Other DBs
NCBI-GeneID: 821851
NCBI-ProteinID: NP_188919
MIPS: AT3G22800.1
TAIR: AT3G22800
Araport: AT3G22800
UniProt: Q9LUI1
Position
3
AA seq 470 aa AA seqDB search
MREDTFFFQWWFLVSGLSFIFLLPQAFTYHTPPINPCFAHPFLPPITNPRLLKAFTALQA
WKFTITSDPNGFTSNWCGPNVCNYTGVFCAPALDNPYVLTVAGIDLNHANIAGYLPLELG
LLTDLALFHINSNRFQGQLPKTLKCLHLLHELDVSNNKLSGEFPSVIFSLPSLKFLDIRF
NEFQGDVPSQLFDLNLDALFINDNKFQFRLPRNIGNSPVSVLVLANNDLQGSCVPPSFYK
MGKTLHEIIITNSQLTGCLNREIGLLNQLTVFDVSYNNLVGSLPETIGDMKSLEQLNIAH
NKFSGYIPESICRLPRLENFTYSYNFFSGEPPACLRLQEFDDRRNCLPSRPMQRSLAECK
SFSSYPIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP
PPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTPVHY
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagacaccttcttcttccagtggtggttcttggtctctggtctcagcttcatc
ttccttcttcctcaagctttcacctaccatactcctccaataaacccgtgcttcgctcat
ccttttcttcctcctatcacaaacccgaggctcttaaaagctttcacagctcttcaagct
tggaagttcaccataacctctgacccaaacggcttcacttctaactggtgcggtcctaat
gtttgtaactacacaggcgtgttttgtgcaccggctctagataacccttatgtcttaacc
gtcgctggtatagacttgaaccatgctaatatcgccggttatctccctttagagcttggt
ctcttaaccgatcttgccttgttccatatcaattccaaccgttttcaaggtcaacttccc
aaaactctaaaatgtctccatcttctccatgagcttgacgtcagcaacaataaactctcc
ggcgagtttccttccgtaatcttctctttgccttccttgaagtttctcgacattaggttc
aatgagttccaaggtgatgttcctagccaactctttgacctaaacctcgacgctctcttc
attaacgacaacaaattccagtttaggttaccgagaaacatcggaaactctccggtttct
gttcttgtcttggccaacaacgatctccaaggatcttgtgtacctccaagtttctacaaa
atggggaaaacattacacgaaatcattatcacgaactcacaactaaccggttgtttaaac
cgggaaatcggtttgcttaaccagttgacggttttcgacgtgagttacaacaacttggtg
ggttcgttgccggagactataggtgatatgaagagtttagagcagttaaacattgcgcat
aacaaattctccggctacattccggagagtatctgccgattaccaaggctcgagaacttc
acttactcgtataacttcttctccggtgagccaccggcttgtttgaggcttcaagagttt
gatgatcgtagaaattgtttaccttcaaggccaatgcaacggtctctcgctgaatgcaaa
tccttttcttcttatcctattgattgtgcatcctttggctgctctccacctagtccaccg
cctcctcctcctcctcctccacctccacctccacctccacctccacctccacctccacct
ccacctccaccaccgccaccatatgtgtatccttcgccgccgccaccacctccatcacct
ccaccatacgtgtatccaccgccaccgccaccatatgtgtatcctccaccgccatcacca
ccatatgtgtatcctccgccaccaccgtcaccgcaaccatatatgtatccttcacctcct
tgtaacgatcttccaacgccggtgcattactaa

DBGET integrated database retrieval system