KEGG   Arabidopsis thaliana (thale cress): AT3G23100Help
Entry
AT3G23100         CDS       T00041                                 

Gene name
XRCC4
Definition
DNA repair protein XRCC4-like protein
Orthology
K10886  
DNA-repair protein XRCC4
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AT3G23100 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 264 aa AA seqDB search
MIGVDSKSSSTTFIETMVESEKTKHTCLRLEISGADPIFVKGTWHNSRFDISVTDGSSSW
ICNATEEEVAERAAQWDQPVSEYLKLAEQYLGFQQPNSVYSFSDALEGSKRLSWTFEKEG
TKLEWRWKCKPSDDSKKITVGILDFLMEANIRLSEEVVNKTRSFEKMRSEAERCLAQGEK
LCDEKTEFESATYAKFLSVLNAKKAKLRALRDKEDSVRVVEEEESTDKAESFESGRSDDE
KSEEEASKKATSSKARGGKRAARS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgatcggagttgactcaaaatcttcgtcgacgacttttatcgaaacaatggttgaatcg
gagaaaacgaaacacacttgtctccgtctcgaaatctccggcgccgatccaattttcgtc
aaaggcacttggcataattctcgtttcgatatctccgtcaccgatggttcctcctcttgg
atttgcaatgcgacggaggaggaagtggcggagagagcagcacaatgggaccagcctgtg
tcagagtatttaaagctcgccgagcaatacttagggtttcaacaacctaattcggtctat
agtttctccgatgctctagagggatctaaacggctctcttggacgtttgagaaggaaggg
actaaacttgagtggaggtggaaatgtaaaccatcagatgatagcaagaagatcactgtt
gggatcttggattttcttatggaggctaacataaggctaagtgaagaagtggtgaacaag
acgagatcttttgagaagatgagaagtgaagctgagagatgtctagcgcaaggtgaaaaa
ctctgtgacgaaaaaacagagtttgagagtgcaacttatgcaaagtttctttctgtttta
aatgcaaagaaggcaaaactgagagcactaagggacaaagaagattcagtgagagtagtt
gaggaggaagagtcgacagacaaagctgaaagctttgagagtggaagaagtgatgatgag
aagagcgaggaagaagcctcaaaaaaggcaacaagcagcaaagcccgtggcgggaagaga
gctgcacgaagctaa

DBGET integrated database retrieval system