KEGG   Arabidopsis thaliana (thale cress): AT3G23940Help
Entry
AT3G23940         CDS       T00041                                 

Definition
(RefSeq) dehydratase family
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AT3G23940
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G23940
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     AT3G23940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
3
AA seq 608 aa AA seqDB search
MQATIFSPRATLFPCKPLLPSHNVNSRRPSIISCSAQSVTADPSPPITDTNKLNKYSSRI
TEPKSQGGSQAILHGVGLSDDDLLKPQIGISSVWYEGNTCNMHLLKLSEAVKEGVENAGM
VGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNMPGT
IMAMGRLNRPGIMVYGGTIKPGHFQDKTYDIVSAFQSYGEFVSGSISDEQRKTVLHHSCP
GAGACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLLELLKMDLKPR
DIITPKSLRNAMVSVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADLKPS
GKYVMEDIHKIGGTPAVLRYLLELGLMDGDCMTVTGQTLAQNLENVPSLTEGQEIIRPLS
NPIKETGHIQILRGDLAPDGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSFKGT
VVVIRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPEAQE
GGPIGLIKNGDIITIDIGKKRIDTQVSPEEMNDRRKKWTAPAYKVNRGVLYKYIKNVQSA
SDGCVTDE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccaccatcttctctccacgcgccactctcttcccctgtaaacctctcctccct
tcccacaatgtcaactctcgccgtccctcaatcatctcctgctccgcccaatccgtaacc
gctgatccttcaccacctatcactgacaccaataagctcaacaaatacagctcaagaatc
actgaacccaaatcccaaggtgggtctcaagcaattcttcacggtgttggtttatcagac
gacgatttgctaaaaccccagattggtatctcgtcggtttggtatgaagggaacacttgt
aacatgcatttgctgaaattgtctgaggctgtgaaagaaggagttgaaaatgcaggaatg
gttgggtttaggtttaatactattggtgtgagtgatgctatttcgatgggaacgagaggg
atgtgttttagtttgcaatctagggatttgattgctgatagtattgagactgttatgagt
gctcagtggtatgatggtaacatatctattcccggttgtgataaaaatatgcctggaact
attatggctatgggaaggcttaacagaccagggattatggtttatggtggaaccattaag
cctggccattttcaagacaagacatatgacattgtatctgctttccagagttatggagaa
tttgttagtggctccataagtgatgaacagagaaagactgtcctccatcattcatgtcct
ggagctggagcctgtggtggcatgtacacagcgaatacaatggcttctgctatcgaagca
atgggaatgtcccttccttacagttcttcaatacctgctgaagacccattgaagttggac
gagtgtcgcttagcaggaaaatatcttctagaattgctaaagatggacttaaaaccccgt
gacattatcactccaaaatcacttcgtaatgcaatggtttccgtcatggcccttggggga
tcgacaaatgcagtattgcatctaattgctattgcaaggtctgttggtttggagttgact
cttgacgattttcagaaagttagcgatgcggttccatttctagcagatcttaaacccagt
gggaagtatgttatggaggatatacataagataggtggtacgccagctgttctccgctat
ttattagagctaggattgatggatggtgattgtatgacagtgacagggcagactttggct
caaaatttagaaaacgtcccaagcttaacagaagggcaggagataattagacctctgtca
aatccaatcaaggagactggacacatacaaattttgagaggagaccttgcaccagatggt
tctgtagcaaaaattaccggcaaagagggcttatatttctctggtcctgcacttgtattt
gaaggagaggaatctatgttggctgctatatcagcagacccaatgagttttaagggaact
gtggttgttatcagaggagaggggcctaaaggaggtccaggtatgcctgagatgttgaca
ccgacaagtgcaataatgggtgccggtcttggaaaggaatgtgcattactgactgatggt
aggttctctggtgggtcacacggttttgttgttggccacatttgccctgaagctcaggag
ggtggtccgatcggtctgatcaagaacggagacataatcaccattgacataggaaagaag
agaatagacacacaagtctcacccgaagaaatgaatgaccgtagaaagaaatggactgct
cctgcatacaaggttaaccgcggagtcctatataagtacatcaagaacgtgcaatcggct
tcagatggatgtgtgactgacgagtaa

DBGET integrated database retrieval system