KEGG   Arabidopsis thaliana (thale cress): AT3G23940Help
Entry
AT3G23940         CDS       T00041                                 

Definition
(RefSeq) dehydratase family protein
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    AT3G23940
   01230 Biosynthesis of amino acids
    AT3G23940
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AT3G23940
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G23940
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     AT3G23940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 608 aa AA seqDB search
MQATIFSPRATLFPCKPLLPSHNVNSRRPSIISCSAQSVTADPSPPITDTNKLNKYSSRI
TEPKSQGGSQAILHGVGLSDDDLLKPQIGISSVWYEGNTCNMHLLKLSEAVKEGVENAGM
VGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNMPGT
IMAMGRLNRPGIMVYGGTIKPGHFQDKTYDIVSAFQSYGEFVSGSISDEQRKTVLHHSCP
GAGACGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLLELLKMDLKPR
DIITPKSLRNAMVSVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADLKPS
GKYVMEDIHKIGGTPAVLRYLLELGLMDGDCMTVTGQTLAQNLENVPSLTEGQEIIRPLS
NPIKETGHIQILRGDLAPDGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSFKGT
VVVIRGEGPKGGPGMPEMLTPTSAIMGAGLGKECALLTDGRFSGGSHGFVVGHICPEAQE
GGPIGLIKNGDIITIDIGKKRIDTQVSPEEMNDRRKKWTAPAYKVNRGVLYKYIKNVQSA
SDGCVTDE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccaccatcttctctccacgcgccactctcttcccctgtaaacctctcctccct
tcccacaatgtcaactctcgccgtccctcaatcatctcctgctccgcccaatccgtaacc
gctgatccttcaccacctatcactgacaccaataagctcaacaaatacagctcaagaatc
actgaacccaaatcccaaggtgggtctcaagcaattcttcacggtgttggtttatcagac
gacgatttgctaaaaccccagattggtatctcgtcggtttggtatgaagggaacacttgt
aacatgcatttgctgaaattgtctgaggctgtgaaagaaggagttgaaaatgcaggaatg
gttgggtttaggtttaatactattggtgtgagtgatgctatttcgatgggaacgagaggg
atgtgttttagtttgcaatctagggatttgattgctgatagtattgagactgttatgagt
gctcagtggtatgatggtaacatatctattcccggttgtgataaaaatatgcctggaact
attatggctatgggaaggcttaacagaccagggattatggtttatggtggaaccattaag
cctggccattttcaagacaagacatatgacattgtatctgctttccagagttatggagaa
tttgttagtggctccataagtgatgaacagagaaagactgtcctccatcattcatgtcct
ggagctggagcctgtggtggcatgtacacagcgaatacaatggcttctgctatcgaagca
atgggaatgtcccttccttacagttcttcaatacctgctgaagacccattgaagttggac
gagtgtcgcttagcaggaaaatatcttctagaattgctaaagatggacttaaaaccccgt
gacattatcactccaaaatcacttcgtaatgcaatggtttccgtcatggcccttggggga
tcgacaaatgcagtattgcatctaattgctattgcaaggtctgttggtttggagttgact
cttgacgattttcagaaagttagcgatgcggttccatttctagcagatcttaaacccagt
gggaagtatgttatggaggatatacataagataggtggtacgccagctgttctccgctat
ttattagagctaggattgatggatggtgattgtatgacagtgacagggcagactttggct
caaaatttagaaaacgtcccaagcttaacagaagggcaggagataattagacctctgtca
aatccaatcaaggagactggacacatacaaattttgagaggagaccttgcaccagatggt
tctgtagcaaaaattaccggcaaagagggcttatatttctctggtcctgcacttgtattt
gaaggagaggaatctatgttggctgctatatcagcagacccaatgagttttaagggaact
gtggttgttatcagaggagaggggcctaaaggaggtccaggtatgcctgagatgttgaca
ccgacaagtgcaataatgggtgccggtcttggaaaggaatgtgcattactgactgatggt
aggttctctggtgggtcacacggttttgttgttggccacatttgccctgaagctcaggag
ggtggtccgatcggtctgatcaagaacggagacataatcaccattgacataggaaagaag
agaatagacacacaagtctcacccgaagaaatgaatgaccgtagaaagaaatggactgct
cctgcatacaaggttaaccgcggagtcctatataagtacatcaagaacgtgcaatcggct
tcagatggatgtgtgactgacgagtaa

DBGET integrated database retrieval system