KEGG   Arabidopsis thaliana (thale cress): AT3G24180Help
Entry
AT3G24180         CDS       T00041                                 

Definition
(RefSeq) Beta-glucosidase, GBA2 type family protein
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00511  Other glycan degradation
ath00600  Sphingolipid metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AT3G24180
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AT3G24180
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AT3G24180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 822004
NCBI-ProteinID: NP_001030757
MIPS: AT3G24180.1
TAIR: AT3G24180
Araport: AT3G24180
UniProt: Q8VZ08
Position
3
AA seq 950 aa AA seqDB search
MVGATLFHRRKHSWPTEEFISRSTLQLLDFDSAAPPPHAWRRRLNCHANILKEFTITFRE
AIKMVRLGIRLWSYVREEASHGRKAPIDPFTKENCKPSASQGVPLGGMGSGSISRGFRGE
FKQWQITPGTCDPSPMMSNQFSIFISRDGGHKKYASVLSPGQHGSLGKSRDKGLSSWGWN
LNGQHSTYHALFPRAWTIYDGEPDPELKISCRQISPFIPNNYRDSSLPAAVFVYTLVNTG
KERAKVSLLFTWANSMGGTSHMSGGHVNEPFIGEDGVSGVLLHHKTGKGNPPVTFAIAAS
ETQNVNVTVLPCFGLSEDSSFTAKDMWDTMEQDGKFDQENFNSGPSTPSLAGDTICAAVS
ASAWVEAHGKCTVSFALSWSSPKVKFSKGSTYDRRYTKFYGTSPRAALDLVHDALTNYKR
WEEDIEAWQNPILRDERLPEWYKFTLFNELYFLVAGGTVWIDSSSLNANGNSQHQQSGLG
NSDGKVGGLDINDQRNDLGNGNSVGVKSNDEVSAIHNRNGLFVDTPHVDDGDDVGRFLYL
EGVEYVMWCTYDVHFYASYALLMLFPKIELNIQRDFAKAVLSEDGRKVKFLAEGNVGIRK
VRGAVPHDLGMHDPWNEMNAYNIHDTSRWKDLNPKFVLQVYRDFAATGDYQFGIDVWPAV
RAAMEYMEQFDRDNDDLIENDGFPDQTYDTWTVHGVSAYCGCLWLAALQAAAAMALQIGD
KFFAELCKNKFLNAKAALETKLWNGSYFNYDSGSSSNSKSIQTDQLAGQWYAASSGLPPL
FEESKIRSTMQKIFDFNVMKTKGGKMGAVNGMHPDGKVDDTCMQSREIWTGVTYAAAATM
ILSGMEEQGFTTAEGIFTAGWSEEGFGYWFQTPEGWTMDGHYRSLIYMRPLAIWGMQWAL
SLPKAILDAPQINMMDRVHLSPRSRRFSNNFKVVKHKAKCFGNSALSCSC
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggttggagcaactttgtttcaccgtagaaagcattcatggccgactgaggaattcatc
agcagaagtactttgcaattgctcgattttgatagtgctgctccgccaccacacgcatgg
aggaggagattaaactgccatgccaatatcttaaaagaattcactattacttttagggaa
gccattaaaatggtacgcttggggatacgattatggtcttatgtcagagaagaggcctcc
catggaaggaaagcacctatcgatcccttcaccaaagagaactgcaaaccatctgcatcc
caaggtgttccactcggaggaatgggaagtggaagcatatctaggggcttcagaggggag
tttaagcagtggcaaatcactcctgggacttgcgatccatcacctatgatgtctaatcag
ttctctatttttatttcacgagatggtggacacaaaaagtatgcatcagttttgtctcca
ggccagcatggaagtttaggaaagtcgcgtgataaaggtctttcttcatggggctggaat
ctgaatggccagcattcaacttatcatgctctatttcctcgggcttggactatatatgat
ggtgagcctgatccagagttaaagatttcctgccggcaaatatcaccttttataccaaac
aattatcgagatagtagtcttccagcagctgtttttgtatatactttggtgaacactgga
aaggaaagggcaaaagtcagccttcttttcacatgggcgaattcaatgggtgggacttca
catatgtcagggggtcatgtgaatgagccattcataggtgaagatggggtctctggcgtc
ctcttacatcacaagacaggcaaaggaaatcctcctgttacatttgcgattgctgcttct
gagactcagaatgttaatgtaactgttttaccatgctttggattgtctgaagatagttct
tttacagcgaaagatatgtgggatacaatggaacaggatgggaaatttgatcaagaaaac
ttcaatagcgggccaagcacaccttcattagctggagacactatttgtgcagcagtctcg
gcttcggcatgggtagaagctcatggcaagtgcactgtgtcttttgcactttcatggtca
tcgccaaaagtgaaattttcaaagggaagcacatatgacaggagatacactaaattttat
ggtacttcgccaagagcagcgttggaccttgtgcatgatgcactgacaaattataagagg
tgggaggaagatattgaagcatggcagaatcccattctcagagatgaaaggctccctgag
tggtacaagttcactctgttcaatgagctttactttttggttgccggtggtacagtttgg
atagactcttcttcactcaatgctaatgggaatagtcagcatcaacaatcgggattagga
aattcagatggtaaggtcggtggacttgacattaatgatcaacggaatgaccttggtaat
ggcaacagcgttggagtaaaaagcaatgatgaagtatcagccattcataaccggaatggt
ttatttgtcgatactccccatgtagatgatggcgatgatgttggtcggtttctgtatttg
gaaggtgtggagtatgtgatgtggtgcacatatgatgtacacttttacgcatcatatgcg
ctccttatgctattcccaaagatcgaactaaacatccagcgtgattttgcgaaagccgtg
ttgtctgaagatggtaggaaggttaagttcctggcagaaggaaatgtgggaattcgcaag
gtcagaggtgctgttcctcacgatctggggatgcatgatccttggaatgaaatgaatgcc
tacaacatacatgacacaagcaggtggaaggatctgaacccaaagtttgtgcttcaggtg
tatagagattttgcagctacaggggattaccaatttggaatagacgtgtggcccgcagtt
cgtgctgctatggagtacatggaacagtttgatagagacaatgacgatctaatagagaat
gatggtttcccagatcagacatatgatacatggactgttcatggcgtgagtgcctactgc
ggttgcctgtggctggctgctcttcaagctgcagcagcaatggctctccaaattggtgac
aaattctttgcagaactttgtaaaaataagtttttgaatgcaaaggcagcactggaaacg
aaactctggaatggatcatacttcaattacgacagtgggtcaagcagcaacagcaaatct
atacagaccgatcagctggcgggtcaatggtatgccgcgtcttcaggtctgcctccatta
tttgaggaatccaaaatcagaagcactatgcaaaagatctttgatttcaatgtgatgaag
acaaaaggaggtaaaatgggtgctgtaaatgggatgcatccggatgggaaagtggatgac
acgtgcatgcagtctcgtgagatatggacaggtgttacttatgcagctgcggctactatg
atcctctctggaatggaagaacaaggtttcaccactgctgagggaattttcacagctggc
tggtcagaagaaggtttcggatattggttccagacaccggaaggttggacaatggatggg
cattaccggtcactgatatacatgagaccgctcgcgatatggggaatgcaatgggcatta
tcgttgccaaaggcaattctggacgctccacagatcaacatgatggacagagtacactta
tcccctagaagccgaagattctcgaacaacttcaaagttgtgaaacacaaggcaaagtgt
tttggtaattcagcattaagctgttcttgctaa

DBGET integrated database retrieval system