KEGG   Arabidopsis thaliana (thale cress): AT3G24650Help
Entry
AT3G24650         CDS       T00041                                 

Gene name
ABI3
Definition
(RefSeq) B3 domain-containing transcription factor ABI3
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 720 aa AA seqDB search
MKSLHVAANAGDLAEDCGILGGDADDTVLMDGIDEVGREIWLDDHGGDNNHVHGHQDDDL
IVHHDPSIFYGDLPTLPDFPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAI
LRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQGFGCGEGGGDCIDMMETFG
YMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMMENNSGGDMQMMNSSL
EQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEW
VQTNHLQRRRTTTTTTNLSYQQSFQQDPFQNPNPNNNNLIPPSDQTCFSPSTWVPPPPQQ
QAFVSDPGFGYMPAPNYPPQPEFLPLLESPPSWPPPPQSGPMPHQQFPMPPTSQYNQFGD
PTGFNGYNMNPYQYPYVPAGQMRDQRLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNN
NNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAVPPQLPPVMETQLPTM
DRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPE
LEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSD
VKCGKYLIRGVKVRQPSGQKPEAPPSSAATKRQNKSQRNINNNSPSANVVVASPTSQTVK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttgcatgtggcggccaacgccggagatctggctgaggattgtggaatactc
ggtggagacgctgatgatactgttttgatggatggaattgatgaagttggtagagagatc
tggttagatgaccatggaggagataataatcatgttcatggtcatcaagatgatgatttg
attgttcatcatgacccttcaatcttctatggagatctcccaacgcttcctgatttccca
tgcatgtcgtcttcatcatcgtcttcaacatctccagctcctgtcaacgcaatcgtctcc
tcagcctcttcttcttcggcagcttcttcctccacttcctcagctgcttcttgggctata
ttgagatcagatggagaagatccgactccaaaccaaaaccaatacgcatcaggaaactgt
gacgactcttctggtgcattgcaatccacagcttccatggagattccattagacagcagt
caaggttttggttgcggcgaaggcggtggtgattgcattgatatgatggagactttcggg
tacatggatctacttgatagcaacgagttctttgacacctcagctatatttagccaagac
gacgacacgcaaaaccctaacttgatggaccaaacccttgagagacaagaagaccaggtc
gttgttccgatgatggagaataacagtggtggagacatgcaaatgatgaattcttccttg
gaacaggacgatgatctcgctgctgtgtttttggagtggctaaagaacaacaaggagact
gtgtcggctgaggatttgaggaaagtaaagataaagaaagctacgattgaatcagcggca
agaagactaggcggtggtaaagaagcgatgaagcagcttttaaagctgattcttgaatgg
gtccaaactaatcacttacaaagaagacgcaccaccaccaccaccaccaacctctcttat
caacaatcattccaacaagatccatttcaaaaccctaaccctaataacaacaacctaatc
ccaccgtccgaccaaacctgtttctcaccttcaacatgggttcctccaccaccacaacaa
caagcttttgtctcggacccgggttttggatacatgcctgctccaaactatccgccacag
ccagagttccttcctttacttgaatctccaccgtcatggccaccaccaccacagtctggt
cccatgccacatcaacaattccccatgccgccaacctcgcagtataatcaatttggagat
ccaacaggtttcaatggatacaacatgaatccgtaccaatatccttatgttcctgcagga
caaatgagagatcagagattactccgtttgtgttcctcagcaactaaagaggcaagaaag
aaacggatggcgagacagaggaggttcttgtctcatcaccacagacataacaacaacaac
aacaacaacaacaataatcagcagaaccaaacccaaatcggagaaacctgtgccgcggtg
gctccacaacttaaccccgtggccacaaccgccacgggagggacctggatgtattggcct
aatgtcccggcagtgccgcctcaattaccgccagtgatggagactcagttacctaccatg
gaccgagctggctcagcttctgctatgccacgtcagcaggtggtaccagatcgccggcag
ggatggaaaccagaaaagaatttgcggtttctcttgcagaaagtcttgaagcaaagcgac
gtgggtaacctcggaaggatcgttttgccaaaaaaagaagctgagacacacttgccggag
ctagaggcaagagacggcatctctctggccatggaagacatcggaacctctcgtgtttgg
aacatgcgctacaggttttggcctaacaacaaaagcaggatgtatctcctcgagaacacc
ggcgattttgtgaaaaccaatgggctccaagaaggtgatttcatagtcatatactccgac
gtcaaatgtggcaaatatttgatacgaggggttaaagtaagacaaccgagcggacaaaag
ccggaggccccaccgtcgtcagcagctacgaagagacaaaacaagtcgcaaaggaacata
aacaataactctccgtcggcgaatgtggtggtcgcttcaccaacttctcaaactgttaaa
tga

DBGET integrated database retrieval system