KEGG   Arabidopsis thaliana (thale cress): AT3G26090Help
Entry
AT3G26090         CDS       T00041                                 

Gene name
RGS1
Definition
(RefSeq) putative membrane receptor protein RGS1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 459 aa AA seqDB search
MASGCALHGGCPSDYVAVAISVICFFVLLSRSVLPCLIHKAPRTNSSSFWIPVIQVISSF
NLLFSIMMSVNLLRFRTKHWWRYCYLWAVWIEGPLGFGLLMSCRITQAFQLYFIFVKKRL
PPVKSYIFLPLVLLPWIFGAAIIHATKPLNDKCHMGLQWTFPVAGLHALYVLALIAFTRA
VRHVEFRFDELRDLWKGILVSATSIVIWVTAFVLNEIHEEISWLQVASRFVLLVTGGILV
VVFFSISSNQPLLSQISLKKRQNFEFQRMGQALGIPDSGLLFRKEEFRPVDPNEPLDKLL
LNKRFRHSFMEFADSCYAGETLHFFEEVYEHGKIPEDDSIRRIYMARHIMEKFIVAGAEM
ELNLSHKTRQEILTTQDLTHTDLFKNALNEVMQLIKMNLVRDYWSSIYFIKFKEEESCHE
AMHKEGYSFSSPRLSSVQGSDDPFYQEHMSKSSRCSSPG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtggatgtgctctacatggtggttgtcccagcgattacgtcgccgtcgcaatt
tcagtcatctgcttcttcgtgctgttatcgcgctcagtgttaccgtgtttgattcataag
gctcctcgtactaacagtagcagtttctggatccctgttattcaagttatctccagcttc
aaccttctcttctcaattatgatgtcagttaatttgcttcgattcaggacgaaacattgg
tggcgatattgctatctttgggcagtgtggattgaaggaccacttgggtttggtttgttg
atgagctgccgtataactcaggcatttcaactatacttcatatttgtcaagaaacgtcta
cctccggtaaaatcatacattttcctcccccttgttttgttgccatggatcttcggagct
gcaattatccacgcaacaaagcctctcaacgataaatgccacatgggtcttcaatggact
ttcccagttgcaggccttcatgctctctatgtccttgctttaattgcattcacaagagca
gttcgacatgtagagtttcgttttgacgagcttagagatctctggaaaggaattctcgtc
tcagccacttcaatcgttatatgggtaacagcgtttgtgttgaatgagattcatgaagaa
atctcttggcttcaggttgcttcaagatttgtgcttttagtcacgggtgggattctcgtc
gttgtcttcttttccatctcgagtaaccaacctcttctttcacaaatcagcttgaagaaa
agacaaaactttgagtttcaaagaatgggtcaagctctaggcattcccgatagcggatta
ttatttcggaaggaggagtttcgacctgttgacccaaacgagccactcgataagcttctt
ctcaataaaagatttcgccattcgtttatggaatttgctgatagctgctacgctggagaa
acattgcatttttttgaagaggtgtatgaacatggtaaaatcccggaagatgattcgata
agaagaatctacatggctcgacatatcatggagaagttcatcgtcgcaggagcggaaatg
gaattgaacttatctcataaaacccgacaagagatcttaaccactcaagatctaactcac
actgatctcttcaagaacgcattaaacgaagtcatgcaattgatcaagatgaacttggta
agagattactggtcatccatctacttcatcaagttcaaagaagaagaaagctgccacgag
gcaatgcataaggaaggatacagtttttcatctccaagactgagttcagttcaaggctct
gatgatcctttctatcaagaacatatgtcaaagagttccagatgcagtagtcccggttaa

DBGET integrated database retrieval system