KEGG   Arabidopsis thaliana (thale cress): AT3G32980Help
Entry
AT3G32980         CDS       T00041                                 

Definition
(RefSeq) Peroxidase family protein
  KO
K00430  
peroxidase [EC:1.11.1.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Phenylpropanoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT3G32980
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     AT3G32980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 352 aa AA seqDB search
MNFSYSSLSTWTTLMTLGCLLLHSSISSAQLTPTFYDNTCPSVFTIVRDTIVNELRSDPR
IAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAAPNANSARGFPVIDRMKAAVETAC
PRTVSCADILTIAAQQAVNLAGGPSWRVPLGRRDSLQAFFALANTNLPAPFFTLPQLKAS
FQNVGLDRPSDLVALSGGHTFGKNQCQFIMDRLYNFSNTGLPDPTLNTTYLQTLRGQCPR
NGNQTVLVDFDLRTPTVFDNKYYVNLKELKGLIQTDQELFSSPNATDTIPLVREYADGTQ
KFFNAFVEAMNRMGNITPLTGTQGQIRQNCRVVNSNSLLHDVVEIVDFVSSM
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctcttattcttccttgtcaacttggacaaccctaatgacattgggttgtctt
ctgcttcattcatccatttccagtgctcagctaaccccaactttctatgacaatacatgt
ccaagcgtctttaccatcgtacgggataccatagtaaacgagctaagatcggatcctcgt
atcgctgcaagcatccttcgtcttcacttccacgactgtttcgtcaatggctgtgatgca
tcgatcctgttagacaacacaacatcctttcgaacagagaaagatgcggctccaaacgca
aactcggctcgaggatttccagtgatcgatagaatgaaagcagcagtagagacagcatgt
ccaaggactgtttcatgcgcagatatacttaccatcgcagctcaacaagctgtaaatttg
gcaggaggtccttcttggagggttcctttggggagaagagatagcttacaagcattcttt
gctctcgctaatacaaatcttcccgctccattcttcactctcccacaacttaaggccagt
tttcaaaatgttggacttgaccgtccctctgatctcgttgcactctctggtggtcacaca
tttggtaaaaaccagtgccaatttattatggatagactatacaactttagcaacactggt
ttacccgaccctactcttaatactacatacctccagacacttcgtggacaatgtccccgc
aatggtaaccagaccgtcttagttgatttcgatctacgcacaccgacggtttttgacaat
aaatactatgtgaatctgaaagagctaaagggacttatccagacggatcaagagttgttt
tccagccctaatgccactgacacaatccccttggtgagagaatacgctgatggcactcaa
aaattcttcaatgcttttgtggaagcaatgaatagaatgggaaacattacacctctcact
ggaactcaaggacaaatcagacagaattgtagggtggttaactccaactcgctgctacat
gatgtggtcgaaatcgttgactttgtcagctctatgtaa

DBGET integrated database retrieval system