KEGG   Arabidopsis thaliana (thale cress): AT3G43860Help
Entry
AT3G43860         CDS       T00041                                 

Gene name
GH9A4
Definition
glycosyl hydrolase 9A4
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT3G43860 (GH9A4)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AT3G43860 (GH9A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 486 aa AA seqDB search
MANYKGRGNVMIRSMLLGLYGIINIVCVNGTFINYKDALTKSLIFLEAQRSGKLPPNNRV
PWRGDSALDDGKLVNVDLSGGYYDAGDNVKYGLPMAFTITTLAWSTITYEKELRATGELE
NARAAIRWGTDYFLKCASRKNRLYVQVGDPNADHQCWARPENMKTPRTVLEISDKVPGTE
IAAEAAAAFAASSIVFRHVDHKYARRLLNKAKLLFKLAKSHKGTYDGECPFYCSNSGYND
ELIWAATWLYKATRNHLYLSYLKFEAISAYVAEFSWDLKYAGAQILITKLIFEGHKGLDL
YKQQADSFVCSNLPGSPYHQVFTTPGGMIHLRDGANSQYVTATAFLFSAYADILQKHNQK
ISCGSHQFDSTHLMAFAKKQIDYILGHNPQGRSYMVGFGPNPPKQAHHRGASVPMHEANA
PLSCPLSFVKWYNKNVPNANELTGAILGGPDRQDKFQDLRWTSVYTEPCTYINSIAVGVL
AKLAAA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctaattataaaggaagaggaaatgttatgatacggagcatgttattgggtctctat
ggcatcataaacattgtgtgtgtcaatggtactttcataaactacaaagatgctttaacc
aaatccctcatcttcttggaggctcaaagatcaggcaaactccctcctaataatagggtt
ccatggagaggtgactctgctctcgacgatggcaaactcgtaaatgtggacttgtctgga
gggtactatgacgcaggagacaatgtgaagtatggtcttccaatggcgttcacgatcaca
acgcttgcttggtccacaattacctacgagaaagaacttcgagccacgggagagctcgaa
aacgctcgtgctgctatccgttggggtacggattatttcctcaaatgtgcttctcgcaag
aaccgcctctatgttcaggttggtgatccaaacgcggaccaccagtgctgggcgagacct
gagaacatgaagacaccaaggacggtgttggagataagcgataaagttccaggaaccgag
atcgcggcggaagccgctgctgcattcgccgcttcctccatcgttttccgccatgtcgac
cacaaatatgcacgccggcttctcaacaaagccaaattgcttttcaagctagccaaaagc
cacaagggtacatacgatggagaatgccccttctattgttctaactccggttacaatgac
gagttgatatgggcggcaacatggctatacaaggcgacaaggaatcatctataccttagc
tacctcaaattcgaagccataagcgcttacgttgccgaattcagctgggatctcaagtac
gctggtgcgcagatcctcatcaccaagttgatcttcgaaggccacaaaggacttgatcta
tacaaacaacaagccgatagttttgtatgctctaacctccctggcagtccttaccaccaa
gtcttcactaccccaggtggtatgattcacttgagggatggtgccaacagtcaatatgtc
accgccaccgccttcttgttctcggcctacgctgatatactacagaaacacaaccaaaag
atctcttgcggtagccaccaattcgattcaacacacctcatggctttcgctaaaaaacag
attgactacatactagggcataacccacaaggaagatcgtacatggttgggttcggacca
aacccaccaaagcaagcccatcacagaggagcctcagtgcccatgcatgaagccaacgcg
ccgctaagctgcccattgagcttcgtgaaatggtacaacaagaacgtacctaacgctaac
gagctcaccggagccattttgggaggacctgaccgtcaagacaaattccaggatctccga
tggacctccgtgtacacagagccttgtacttacatcaactctatcgccgttggtgttctc
gctaagctcgctgcggcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system