KEGG   Arabidopsis thaliana (thale cress): AT3G44460Help
Entry
AT3G44460         CDS       T00041                                 

Gene name
DPBF2
Definition
(RefSeq) basic leucine zipper transcription factor 67
  KO
K14432  
ABA responsive element binding factor
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT3G44460 (DPBF2)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AREB/ABF
    AT3G44460 (DPBF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 331 aa AA seqDB search
MSVFESETSNFHVYNNHEIQTQPQMQTFLSEEEPVGRQNSILSLTLDEIQMKSGKSFGAM
NMDEFLANLWTTVEENDNEGGGAHNDGEKPAVLPRQGSLSLPVPLCKKTVDEVWLEIQNG
VQQHPPSSNSGQNSAENIRRQQTLGEITLEDFLVKAGVVQEPLKTTMRMSSSDFGYNPEF
GVGLHCQNQNNYGDNRSVYSENRPFYSVLGESSSCMTGNGRSNQYLTGLDAFRIKKRIID
GPPEILMERRQRRMIKNRESAARSRARRQAYTVELELELNNLTEENTKLKEIVEENEKKR
RQEIISRSKQVTKEKSGDKLRKIRRMASAGW
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttcgaatcggagacttcgaacttccacgtctacaacaaccacgaaatccaa
acgcaaccgcaaatgcaaacgtttctgtcggaggaggaaccggtagggagacagaactcg
attttgtcactaactcttgacgaaattcagatgaaaagcggtaagagctttggagcgatg
aacatggacgagttcctagcgaacttgtggacaaccgttgaagaaaacgacaacgaagga
ggtggggctcacaacgacggagagaagccggcggtgctgccacgtcaagggtcgttgtcc
ctccctgtgcctttatgcaagaaaacggtcgacgaggtttggctcgagatacaaaacggt
gtacaacaacatccaccgtcgtcgaattccggtcaaaactccgccgaaaatattcgccgg
caacaaacccttggtgagatcactctcgaggattttcttgttaaggctggtgttgtacaa
gaaccgttgaagacaacgatgaggatgtcgagttctgattttggttataaccccgagttt
ggagttggtttacattgtcagaaccaaaacaattatggtgataaccggtcggtttatagt
gaaaaccgaccgttttactcggttttgggagaatcttcaagctgtatgaccgggaatggg
aggagtaatcagtatctgaccggtttagatgcttttcggatcaagaaacggataattgat
ggtccacctgaaattttgatggagcggagacaacggcgaatgattaaaaaccgcgaatct
gcggctcggtctcgagcccggagacaagcttatactgtggaactggagttggaattgaac
aacctcacggaagaaaacacgaagctgaaggaaattgtggaggaaaatgagaagaaaaga
agacaagagataataagtagaagcaaacaagtgactaaagagaagagcggagacaaattg
agaaagattcggaggatggccagtgccgggtggtaa

DBGET integrated database retrieval system