KEGG   Arabidopsis thaliana (thale cress): AT3G44460Help
Entry
AT3G44460         CDS       T00041                                 

Gene name
DPBF2
Definition
(RefSeq) Basic-leucine zipper (bZIP) transcription factor family protein
  KO
K14432  ABA responsive element binding factor
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT3G44460 (DPBF2)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AREB/ABF
    AT3G44460 (DPBF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 TMEM247 Endonuc_Holl
Motif
Other DBs
NCBI-GeneID: 823571
NCBI-ProteinID: NP_566870
MIPS: AT3G44460.1
TAIR: AT3G44460
Araport: AT3G44460
UniProt: Q8RYD6
Position
3
AA seq 331 aa AA seqDB search
MSVFESETSNFHVYNNHEIQTQPQMQTFLSEEEPVGRQNSILSLTLDEIQMKSGKSFGAM
NMDEFLANLWTTVEENDNEGGGAHNDGEKPAVLPRQGSLSLPVPLCKKTVDEVWLEIQNG
VQQHPPSSNSGQNSAENIRRQQTLGEITLEDFLVKAGVVQEPLKTTMRMSSSDFGYNPEF
GVGLHCQNQNNYGDNRSVYSENRPFYSVLGESSSCMTGNGRSNQYLTGLDAFRIKKRIID
GPPEILMERRQRRMIKNRESAARSRARRQAYTVELELELNNLTEENTKLKEIVEENEKKR
RQEIISRSKQVTKEKSGDKLRKIRRMASAGW
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttcgaatcggagacttcgaacttccacgtctacaacaaccacgaaatccaa
acgcaaccgcaaatgcaaacgtttctgtcggaggaggaaccggtagggagacagaactcg
attttgtcactaactcttgacgaaattcagatgaaaagcggtaagagctttggagcgatg
aacatggacgagttcctagcgaacttgtggacaaccgttgaagaaaacgacaacgaagga
ggtggggctcacaacgacggagagaagccggcggtgctgccacgtcaagggtcgttgtcc
ctccctgtgcctttatgcaagaaaacggtcgacgaggtttggctcgagatacaaaacggt
gtacaacaacatccaccgtcgtcgaattccggtcaaaactccgccgaaaatattcgccgg
caacaaacccttggtgagatcactctcgaggattttcttgttaaggctggtgttgtacaa
gaaccgttgaagacaacgatgaggatgtcgagttctgattttggttataaccccgagttt
ggagttggtttacattgtcagaaccaaaacaattatggtgataaccggtcggtttatagt
gaaaaccgaccgttttactcggttttgggagaatcttcaagctgtatgaccgggaatggg
aggagtaatcagtatctgaccggtttagatgcttttcggatcaagaaacggataattgat
ggtccacctgaaattttgatggagcggagacaacggcgaatgattaaaaaccgcgaatct
gcggctcggtctcgagcccggagacaagcttatactgtggaactggagttggaattgaac
aacctcacggaagaaaacacgaagctgaaggaaattgtggaggaaaatgagaagaaaaga
agacaagagataataagtagaagcaaacaagtgactaaagagaagagcggagacaaattg
agaaagattcggaggatggccagtgccgggtggtaa

DBGET integrated database retrieval system