KEGG   Arabidopsis thaliana (thale cress): AT3G44890Help
Entry
AT3G44890         CDS       T00041                                 

Gene name
RPL9
Definition
(RefSeq) ribosomal protein L9
  KO
K02939  
large subunit ribosomal protein L9
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ribosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    AT3G44890 (RPL9)
Ribosome [BR:ath03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    AT3G44890 (RPL9)
  Bacteria
    AT3G44890 (RPL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
3
AA seq 197 aa AA seqDB search
MASSTALSLSWSSSPCWSHSFNGGANETLKVSERRFNFEVVSQKKAKKLRKVILKEDVTD
LGKQGQLLDVKAGFFRNFLLPTGKAQLMTPLLLKELKMEDERIEAEKQRVKEEAQQLAMV
FQTVGAFKVKRKGGKGKLIFGSVTAQDLVDIIKSQLQKDIDKRLVSLPEIRETGEYIAEL
KLHPDVTARVKINVFAN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcgacagctttgtctctctcatggagctcctctccttgttggtcacacagc
ttcaatggcggtgcaaatgaaaccctaaaagtatctgagcgaaggttcaattttgaagtt
gtttcccagaagaaagctaagaaacttcgcaaggtaattttgaaagaggatgtgacggat
ttgggtaagcaagggcaattacttgatgtgaaagctggatttttcagaaacttcctcttg
cctactggaaaggctcagcttatgactccacttctgctcaaggaattgaagatggaagac
gaacggattgaggcagagaagcaaagggtgaaagaagaggcacaacaactggcgatggta
ttccaaaccgttggtgctttcaaggttaaacgcaaaggcggtaaaggcaaactgatattt
ggatctgtcacagctcaagacctcgtcgacatcatcaaatcacagctccaaaaggacatc
gacaaacgccttgtctctctcccagaaatccgtgaaaccggagaatacatagccgaactc
aagcttcaccccgatgtcactgctcgagttaagatcaatgttttcgctaactaa

DBGET integrated database retrieval system