KEGG   Arabidopsis thaliana (thale cress): AT3G45150Help
Entry
AT3G45150         CDS       T00041                                 

Gene name
TCP16
Definition
(RefSeq) transcription factor TCP16
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
3
AA seq 165 aa AA seqDB search
MDSKNGINNSQKARRTPKDRHLKIGGRDRRIRIPPSVAPQLFRLTKELGFKTDGETVSWL
LQNAEPAIFAATGHGVTTTSNEDIQPNRNFPSYTFNGDNISNNVFPCTVVNTGHRQMVFP
VSTMTDHAPSTNYSTISDNYNSTFNGNATASDTTSAATTTATTTV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaaaaatggaattaacaacagccaaaaggcaagaaggactccaaaagaccgc
catttgaaaattggtggccgtgatcgtcgcattcggatcccgccgagtgttgctccccaa
ctatttagattgacaaaagaactcggctttaaaaccgatggtgaaactgtcagttggctc
ctccagaatgccgagcctgccattttcgcagccacgggacatggtgtcaccaccacctcc
aatgaagatatccagccaaataggaattttcctagttacacctttaatggtgataatatt
agtaataacgttttcccttgtacggttgtaaatactggtcatcgtcagatggtgtttccg
gtttctacaatgacagatcatgcaccttcaactaattacagtactattagtgataattac
aattccacctttaatggtaatgctaccgccagtgatacaacatcagcagcaacaacaaca
gccacaaccacagtttga

DBGET integrated database retrieval system